Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF THE AHSA1-LIKE PROTEIN RHE_CH02687 (1-152) FROM RHIZOBIUM ETLI, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET RER242
 
Authors :  Y. Yang, T. A. Ramelot, J. R. Cort, D. Wang, C. Ciccosanti, H. Janjua, R. N B. Rost, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kenn Northeast Structural Genomics Consortium (Nesg)
Date :  16 Mar 11  (Deposition) - 13 Apr 11  (Release) - 22 Feb 12  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Nesg, Structural Genomics, Northeast Structural Genomics Consortium, Psi-Biology, Structure Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Yang, T. A. Ramelot, J. R. Cort, D. Wang, C. Ciccosanti, H. Janjua, R. Nair, B. Rost, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kennedy
Solution Nmr Structure Of The Ahsa1-Like Protein Rhe_ch0268 (1-152) From Rhizobium Etli, Northeast Structural Genomics Consortium Target Rer242
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - AHSA1-LIKE PROTEIN RHE_CH02687
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET 21-23C
    Expression System Strain: BL21(DE3) PMGK
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RHE_CH02687
    Organism Scientific: RHIZOBIUM ETLI
    Organism Taxid: 347834
    Other Details: C-TAG SEQUENCE: LEHHHHHH
    Strain: CFN 42

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LAK)

(-) Sites  (0, 0)

(no "Site" information available for 2LAK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LAK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LAK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LAK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LAK)

(-) Exons   (0, 0)

(no "Exon" information available for 2LAK)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:160
 aligned with Q2K6S8_RHIEC | Q2K6S8 from UniProtKB/TrEMBL  Length:152

    Alignment length:160
                                                                                                                                                                                 152        
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150 |       -
         Q2K6S8_RHIEC     1 MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIEQGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRR--------   -
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----------------AHSA1-2lakA01 A:18-139                                                                                                    --------------------- Pfam domains
         Sec.struct. author .........eeeeeeee..hhhhhhhhhhhhhhhhhh....eee.......eee...........eeeee...eeee...............eeeeeeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2lak A   1 MEKAMPESFVVRREAHLAAPPAAVFALMTDPEKILRWMGTEAEVEPEPGGLYLVNVTGARFARGSFREVVPVHRLAYSFGWDGSEVVPPGSSLVEIDLIEQGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLEHHHHHH 160
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LAK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LAK)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Bet_V_1_like (93)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q2K6S8_RHIEC | Q2K6S8)
biological process
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lak)
 
  Sites
(no "Sites" information available for 2lak)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lak)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lak
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2K6S8_RHIEC | Q2K6S8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q2K6S8_RHIEC | Q2K6S8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2LAK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LAK)