2L03 - JenaLib

Title :   SPATIAL STRUCTURE OF WATER-SOLUBLE LYNX1

Authors :   K. S. Mineev, Z. O. Shenkarev, A. S. Arseniev

Date :   30 Jun 10 (Deposition) - 19 Jan 11 (Release) - 01 Oct 14 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)
NMR Structure *: A  (1x)

Keywords :   Lynx1, Acetylcholine Receptor, Endogenic Neuromodulator, Three-Finger Toxins, Neuropeptide (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. N. Lyukmanova, Z. O. Shenkarev, M. A. Shulepko, K. S. Mineev, D. D'Hoedt, I. E. Kasheverov, S. Y. Filkin, A. P. Krivolapova, H. Janickova, V. Dolezal, D. A. Dolgikh, A. S. Arseniev, D. Bertrand, V. I. Tsetlin, M. P. Kirpichnikov
Nmr Structure And Action On Nicotinic Acetylcholine Receptors Of Water-Soluble Domain Of Human Lynx1
J. Biol. Chem. V. 286 10618 2011
PubMed-ID: 21252236 | Reference-DOI: 10.1074/JBC.M110.189100

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (5, 5)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:74
 aligned with LYNX1_HUMAN | Q9BZG9 from UniProtKB/Swiss-Prot  Length:131

    Alignment length:112
                                                                                                                               120          
                                                                                                                             119 |          
                                    29        39        49        59        69        79        89        99       109       119 |     128  
          LYNX1_HUMAN    20 ALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVS-IACCQTSLCNH 130
               SCOP domains ---------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---UPAR_LY6-2l03A01 A:4-40      ------------------------------        ------------------------------------------ Pfam domains
         Sec.struct. author ..eee.eee.......eee......eeeeeee------------------------------eee..eee--------eeeeee...............eeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 2l03 A   1 MLDCHVCAYNGDNCFNPMRCPAMVAYCMTTRT------------------------------YYTPTRMK--------VSKSCVPRCFETVYDGYSKHASTTSCCQYDLCNG  74
                                    10        20        30 |       -         -         -  |     40        42        52        62        72  
                                                          32                             33     40       41

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (10, 10)

NMR Structure(hide GO term definitions)

Chain A (LYNX1_HUMAN | Q9BZG9)

molecular function
	GO:0030550	acetylcholine receptor inhibitor activity	Interacting (directly or indirectly) with acetylcholine receptors such that the proportion of receptors in the active form is decreased.
	GO:0008200	ion channel inhibitor activity	Stops, prevents, or reduces the activity of an ion channel.
biological process
	GO:2000272	negative regulation of receptor activity	Any process that stops, prevents or reduces the frequency, rate or extent of receptor activity.
cellular component
	GO:0031225	anchored component of membrane	The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l03)

	Sites
(no "Sites" information available for 2l03)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l03)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2l03
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LYNX1_HUMAN \| Q9BZG9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LYNX1_HUMAN \| Q9BZG9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description