Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF ALPHA-MANNOSIDASE BINDING DOMAIN OF ATG34
 
Authors :  Y. Watanabe, N. Noda, H. Kumeta, K. Suzuki, Y. Ohsumi, F. Inagaki
Date :  18 Jun 10  (Deposition) - 21 Jul 10  (Release) - 12 Mar 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Selective Autophagy, Atg34, Alpha-Mannosidase, Atg19, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Watanabe, N. N. Noda, H. Kumeta, K. Suzuki, Y. Ohsumi, F. Inagaki
Selective Transport Of Alpha-Mannosidase By Autophagic Pathways: Structural Basis For Cargo Recognition By Atg19 And Atg34.
J. Biol. Chem. V. 285 30026 2010
PubMed-ID: 20659891  |  Reference-DOI: 10.1074/JBC.M110.143545

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN YOL083W
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PGEX-6P-1
    Expression System Vector Type: VECTOR
    Fragment: ALPHA-MANNOSIDASE BINDING DOMAIN
    Gene: YOL083W, O0957
    Organism Common: YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KZK)

(-) Sites  (0, 0)

(no "Site" information available for 2KZK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KZK)

(-) Cis Peptide Bonds  (2, 40)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Phe A:309 -Pro A:310
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Thr A:314 -Pro A:315

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KZK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KZK)

(-) Exons   (0, 0)

(no "Exon" information available for 2KZK)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
 aligned with ATG34_YEAST | Q12292 from UniProtKB/Swiss-Prot  Length:412

    Alignment length:103
                                   255       265       275       285       295       305       315       325       335       345   
          ATG34_YEAST   246 NDPLLHVEVSNEDNSLHFILYNKTNIIIPGNCTFEFSSQISEVFSIKMGPHEIGIKGQKELWFFPSLPTPLSNYTMKVVNQDGETILVGKCADSNEITLKSPL 348
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ATG19_autophagy-2kzkA01 A:246-348                                                                       Pfam domains
         Sec.struct. author .....eeee........eeee...........eee......................eee................eee.....eeee............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 2kzk A 246 NDPLLHVEVSNEDNSLHFILYNKTNIIIPGNCTFEFSSQISEVFSIKMGPHEIGIKGQKELWFFPSLPTPLSNYTMKVVNQDGETILVGKCADSNEITLKSPL 348
                                   255       265       275       285       295       305       315       325       335       345
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KZK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KZK)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: ATG19_autophagy] (2)

(-) Gene Ontology  (11, 11)

NMR Structure(hide GO term definitions)
Chain A   (ATG34_YEAST | Q12292)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
biological process
    GO:0006914    autophagy    The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0031503    protein complex localization    A localization process that acts on a protein complex; the complex is transported to, or maintained in, a specific location.
    GO:0071211    protein targeting to vacuole involved in autophagy    The process of directing proteins towards the vacuole using signals contained within the protein, occurring as part of autophagy, the process in which cells digest parts of their own cytoplasm.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0034270    CVT complex    A protein complex that is involved in the CVT pathway. In budding yeast, the CVT complex consists of multimers of preApe1p.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0034045    pre-autophagosomal structure membrane    A cellular membrane associated with the pre-autophagosomal structure.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kzk)
 
  Sites
(no "Sites" information available for 2kzk)
 
  Cis Peptide Bonds
    Phe A:309 - Pro A:310   [ RasMol ]  
    Thr A:314 - Pro A:315   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kzk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ATG34_YEAST | Q12292
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ATG34_YEAST | Q12292
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KZK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KZK)