|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| NMR Structure (3, 6) NMR Structure * (2, 4) |
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2KY8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KY8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KY8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KY8) |
Exons (0, 0)| (no "Exon" information available for 2KY8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:70 aligned with Q5EFL0_CHICK | Q5EFL0 from UniProtKB/TrEMBL Length:257 Alignment length:70 11 21 31 41 51 61 71 Q5EFL0_CHICK 2 DKQGRTDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSCFDFRTGKMM 71 SCOP domains d2ky8a_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------- CATH domains Pfam domains MBD-2ky8A01 A:3-72 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2ky8 A 3 DKQGRTDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSCFDFRTGKMM 72 12 22 32 42 52 62 72
Chain B from PDB Type:DNA Length:11
2ky8 B 100 GGAATcGGCtC 110
| 109
105-5CM
109-TED
Chain C from PDB Type:DNA Length:11
2ky8 C 111 GAGCcGATtCC 121
| 120
| |
115-5CM
119-TED
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KY8) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q5EFL0_CHICK | Q5EFL0)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|