Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF GS-ALFA-KTX5.4 SYNTHETIC SCORPION LIKE
 
Authors :  F. Del Rio-Portilla, B. E. Ramirez-Cordero, L. Brieba-De Castro
Date :  14 May 10  (Deposition) - 01 Jun 11  (Release) - 08 Oct 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (17x)
NMR Structure *:  A  (1x)
Keywords :  Alpha/Beta Scaffold, Beta Sheet, Alpha Helix, Scoprion K+ Toxin, Gs- Alpha-Ktx5. 4, Aktx5. 4, Mesobuthus Tamulus, Potassium Blocker, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Ramirez-Cordero, Y. Toledano, P. Cano-Sanchez, R. Hernandez-Lopez, D. Flores-Solis, A. L. Saucedo-Yanez, I. Chavez-Uribe, L. G. Brieba, F. Del Rio-Portilla
Cytotoxicity Of Recombinant Tamapin And Related Toxin-Like Peptides On Model Cell Lines.
Chem. Res. Toxicol. V. 27 960 2014
PubMed-ID: 24821061  |  Reference-DOI: 10.1021/TX4004193
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POTASSIUM CHANNEL TOXIN ALPHA-KTX 5.4
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: ROSETTA DE3 GAMI
    Expression System Taxid: 469008
    Expression System Vector: MODIFIED PET32A
    Organism Common: EASTERN INDIAN SCORPION
    Organism Scientific: MESOBUTHUS TAMULUS
    Organism Taxid: 34647
    Synonym: TAMAPIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (17x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KY3)

(-) Sites  (0, 0)

(no "Site" information available for 2KY3)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:5 -A:23
2A:10 -A:28
3A:14 -A:30

(-) Cis Peptide Bonds  (1, 1)

NMR Structure
No.Residues
1Ile A:24 -Gly A:25

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KY3)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX54_MESTA8-28  1A:10-30
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX54_MESTA8-28  1A:10-30

(-) Exons   (0, 0)

(no "Exon" information available for 2KY3)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:33
 aligned with KAX54_MESTA | P59869 from UniProtKB/Swiss-Prot  Length:31

    Alignment length:33
                              1                              
                              |      8        18        28   
           KAX54_MESTA    - --AFCNLRRCELSCRSLGLLGKCIGEECKCVPY 31
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --Toxin_2-2ky3A01 A:3-31       -- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhh.eee......eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE ---------SCORP_SHORT_TOXIN    --- PROSITE
                 Transcript --------------------------------- Transcript
                  2ky3 A  1 GSAFCNLRRCELSCRSLGLLGKCIGEECKCVPY 33
                                    10        20        30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KY3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KY3)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Knottin_1 (78)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (KAX54_MESTA | P59869)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ky3)
 
  Sites
(no "Sites" information available for 2ky3)
 
  Cis Peptide Bonds
    Ile A:24 - Gly A:25   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ky3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAX54_MESTA | P59869
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KAX54_MESTA | P59869
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAX54_MESTA | P59869: 2cf1 2lu9 2me7 2mel 2men 2meo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KY3)