Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF A BACTERIAL CYCLIC NUCLEOTIDE-ACTIVATED K+ CHANNEL BINDING DOMAIN IN THE UNLIGANDED STATE
 
Authors :  S. Schunke, M. Stoldt, D. Willbold
Date :  10 May 10  (Deposition) - 20 Apr 11  (Release) - 27 Apr 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
NMR Structure *:  A  (1x)
Keywords :  Cyclic Nucleotide Binding Domain (Cnbd), Ion Channel, Protein Phosphate Binding Cassette In The Apo State, Helical Portion, Beta Barrel Core, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Schunke, M. Stoldt, J. Lecher, U. B. Kaupp, D. Willbold
Structural Insights Into Conformational Changes Of A Cyclic Nucleotide-Binding Domain In Solution From Mesorhizobium Loti K1 Channel.
Proc. Natl. Acad. Sci. Usa V. 108 6121 2011
PubMed-ID: 21430265  |  Reference-DOI: 10.1073/PNAS.1015890108

(-) Compounds

Molecule 1 - CYCLIC NUCLEOTIDE-GATED POTASSIUM CHANNEL MLL3241
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)PLYSE
    Expression System Taxid469008
    Expression System VectorPGEX-2T
    FragmentUNP RESIDUES 216-355
    GeneMLL3241
    Organism ScientificMESORHIZOBIUM LOTI
    Organism Taxid381
    SynonymMLOTIK1 CHANNEL

 Structural Features

(-) Chains, Units

  1
NMR Structure (15x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KXL)

(-) Sites  (0, 0)

(no "Site" information available for 2KXL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KXL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KXL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KXL)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.CNGK1_RHILO235-348  1A:235-348
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.CNGK1_RHILO262-278  1A:262-278
3CNMP_BINDING_2PS00889 Cyclic nucleotide-binding domain signature 2.CNGK1_RHILO296-313  1A:296-313
NMR Structure * (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.CNGK1_RHILO235-348  1A:235-348
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.CNGK1_RHILO262-278  1A:262-278
3CNMP_BINDING_2PS00889 Cyclic nucleotide-binding domain signature 2.CNGK1_RHILO296-313  1A:296-313

(-) Exons   (0, 0)

(no "Exon" information available for 2KXL)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:142
 aligned with CNGK1_RHILO | Q98GN8 from UniProtKB/Swiss-Prot  Length:355

    Alignment length:145
                                   220       230       240       250       260       270       280       290       300       310       320       330       340       350     
          CNGK1_RHILO   211 ATGFYQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA 355
               SCOP domains d2   kxla_ A: automated matches                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------cNMP_binding-2kxlA01 A:253-336                                                      ------------------- Pfam domains
         Sec.struct. author ..---......hhhhhhhhhh.........hhhhhhhhhh.eeeee....eee.......eeeeeee..eee.....eee....ee.hhhhhh.......eee...eeeeeeehhhhhhhhhh.hhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------CNMP_BINDING_3  PDB: A:235-348 UniProt: 235-348                                                                   ------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------CNMP_BINDING_1   -----------------CNMP_BINDING_2    ------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kxl A 214 GS---QEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA 355
                             |   | 220       230       240       250       260       270       280       290       300       310       320       330       340       350     
                             | 216                                                                                                                                           
                           215                                                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KXL)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (12, 12)

NMR Structure(hide GO term definitions)
Chain A   (CNGK1_RHILO | Q98GN8)
molecular function
    GO:0030552    cAMP binding    Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005267    potassium channel activity    Enables the facilitated diffusion of a potassium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005249    voltage-gated potassium channel activity    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:0006813    potassium ion transport    The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kxl)
 
  Sites
(no "Sites" information available for 2kxl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kxl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kxl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CNGK1_RHILO | Q98GN8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CNGK1_RHILO | Q98GN8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CNGK1_RHILO | Q98GN81u12 1vp6 2k0g 2zd9 3beh 3cl1 3clp 3co2 4chv 4chw 4muv

(-) Related Entries Specified in the PDB File

2k0g SOLUTION STRUCTURE OF A BACTERIAL CYCLIC NUCLEOTIDE- ACTIVATED K+ CHANNEL BINDING DOMAIN IN COMPLEX WITH CAMP