|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
NMR Structure (1, 4)
|
NMR Structure (4, 4)
|
(no "SS Bond" information available for 2KSU) |
(no "Cis Peptide Bond" information available for 2KSU) |
(no "SAP(SNP)/Variant" information available for 2KSU) |
(no "PROSITE Motif" information available for 2KSU) |
(no "Exon" information available for 2KSU) |
NMR StructureChain A from PDB Type:PROTEIN Length:107 aligned with B8J2Z0_DESDA | B8J2Z0 from UniProtKB/TrEMBL Length:128 Alignment length:107 31 41 51 61 71 81 91 101 111 121 B8J2Z0_DESDA 22 APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHAKGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP 128 SCOP domains d2ksua_ A: Cytochrome c3 SCOP domains CATH domains 2ksuA00 A:1-107 Cytochrome C3 CATH domains Pfam domains Cytochrom_CIII-2ksuA01 A:1-106 - Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------- Transcript 2ksu A 1 APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHARGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP 107 10 20 30 40 50 60 70 80 90 100 Chain A from PDB Type:PROTEIN Length:107 aligned with Q9L915_DESDE | Q9L915 from UniProtKB/TrEMBL Length:128 Alignment length:107 31 41 51 61 71 81 91 101 111 121 Q9L915_DESDE 22 APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHAKGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP 128 SCOP domains d2ksua_ A: Cytochrome c3 SCOP domains CATH domains 2ksuA00 A:1-107 Cytochrome C3 CATH domains Pfam domains Cytochrom_CIII-2ksuA01 A:1-106 - Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------- Transcript 2ksu A 1 APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHARGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP 107 10 20 30 40 50 60 70 80 90 100
|
NMR Structure |
NMR Structure
|
NMR Structure |
NMR Structure(hide GO term definitions) Chain A (Q9L915_DESDE | Q9L915)
Chain A (B8J2Z0_DESDA | B8J2Z0)
|
|
|
|
|
|
|