Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE AND DYNAMICS OF THE MEMBRANE-BOUND FORM OF PF1 COAT PROTEIN: IMPLICATIONS FOR STRUCTURAL REARRANGEMENT DURING VIRUS ASSEMBLY
 
Authors :  S. Park, F. Marassi, D. Black, S. J. Opella
Date :  05 Jan 10  (Deposition) - 10 Nov 10  (Release) - 10 Nov 10  (Revision)
Method :  SOLUTION NMR; SOLID-STATE NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Membrane Protein, Capsid Protein, Host Membrane, Membrane, Transmembrane, Virion, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. H. Park, F. M. Marassi, D. Black, S. J. Opella
Structure And Dynamics Of The Membrane-Bound Form Of Pf1 Coat Protein: Implications Of Structural Rearrangement For Virus Assembly.
Biophys. J. V. 99 1465 2010
PubMed-ID: 20816058  |  Reference-DOI: 10.1016/J.BPJ.2010.06.009

(-) Compounds

Molecule 1 - CAPSID PROTEIN G8P
    ChainsA
    EngineeredYES
    FragmentUNP RESIDUES 37-82
    GeneVIII
    Organism CommonBACTERIOPHAGE PF1
    Organism ScientificPSEUDOMONAS PHAGE PF1
    Organism Taxid10871
    SynonymGENE 8 PROTEIN, G8P, COAT PROTEIN B, MAJOR COAT PROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KSJ)

(-) Sites  (0, 0)

(no "Site" information available for 2KSJ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KSJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KSJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KSJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KSJ)

(-) Exons   (0, 0)

(no "Exon" information available for 2KSJ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:46
 aligned with CAPSD_BPPF1 | P03621 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:46
                                    46        56        66        76      
           CAPSD_BPPF1   37 GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 82
               SCOP domains d2ksja_ A:                                     SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains Phage_Coat_B-2ksjA01 A:1-46                    Pfam domains
         Sec.struct. author ...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                  2ksj A  1 GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 46
                                    10        20        30        40      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KSJ)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (CAPSD_BPPF1 | P03621)
cellular component
    GO:0019029    helical viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles; the subunits are arranged to form a protein helix with the genetic material contained within. Tobacco mosaic virus has such a capsid structure.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ksj)
 
  Sites
(no "Sites" information available for 2ksj)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ksj)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ksj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAPSD_BPPF1 | P03621
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CAPSD_BPPF1 | P03621
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAPSD_BPPF1 | P036211ifm 1ifn 1pfi 1pjf 1ql1 1ql2 1zn5 2ifm 2ifn 2klv 2xkm 3ifm 4ifm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KSJ)