|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2KPI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KPI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KPI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KPI) |
Exons (0, 0)| (no "Exon" information available for 2KPI) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:56 aligned with Q9KZL7_STRCO | Q9KZL7 from UniProtKB/TrEMBL Length:56 Alignment length:56 10 20 30 40 50 Q9KZL7_STRCO 1 MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE 56 SCOP domains -------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains ---Trm112p-2kpiA01 A:4-43 ------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 2kpi A 1 MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE 56 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KPI) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KPI) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (Q9KZL7_STRCO | Q9KZL7)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|