|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KLV) |
Sites (0, 0)| (no "Site" information available for 2KLV) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KLV) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KLV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KLV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KLV) |
Exons (0, 0)| (no "Exon" information available for 2KLV) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with CAPSD_BPPF1 | P03621 from UniProtKB/Swiss-Prot Length:82 Alignment length:46 46 56 66 76 CAPSD_BPPF1 37 GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 82 SCOP domains d2klva_ A: SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains Phage_Coat_B-2klvA01 A:1-46 Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------- PROSITE Transcript ---------------------------------------------- Transcript 2klv A 1 GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 46 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KLV) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (CAPSD_BPPF1 | P03621)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|