|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KL3) |
Sites (0, 0)| (no "Site" information available for 2KL3) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KL3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KL3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KL3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KL3) |
Exons (0, 0)| (no "Exon" information available for 2KL3) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:132 aligned with Q8YQN0_NOSS1 | Q8YQN0 from UniProtKB/TrEMBL Length:151 Alignment length:132 25 35 45 55 65 75 85 95 105 115 125 135 145 Q8YQN0_NOSS1 16 IEPQSDAHVLKSRLEWGEPAFTILDVRDRSTYNDGHIMGAMAMPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEGIIESRTPAGADDYNVVSRMQNHLENQ 147 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains -----Rhodanese-2kl3A01 A:6-100 -------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript 2kl3 A 1 MEPQSDAHVLKSRLEWGEPAFTILDVRDRSTYNDGHIMGAMAMPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEGIIESRTPAGADDYNVVSRLEHHHHHH 132 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KL3) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KL3) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2KL3)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|