Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE SOLUTION STRUCTURE OF RPP29-RPP21 COMPLEX FROM PYROCOCCUS FURIOSUS
 
Authors :  Y. Xu, M. P. Foster
Date :  28 Apr 09  (Deposition) - 15 Sep 09  (Release) - 10 Nov 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (10x)
Keywords :  Rnase P, Nmr, Hydrolase, Trna Processing (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Xu, C. D. Amero, D. K. Pulukkunat, V. Gopalan, M. P. Foster
Solution Structure Of An Archaeal Rnase P Binary Protein Complex: Formation Of The 30-Kda Complex Between Pyrococcus Furiosus Rpp21 And Rpp29 Is Accompanied By Coupled Protein Folding And Highlights Critical Features For Protein-Protein And Protein-Rna Interactions.
J. Mol. Biol. V. 393 1043 2009
PubMed-ID: 19733182  |  Reference-DOI: 10.1016/J.JMB.2009.08.068
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RIBONUCLEASE P PROTEIN COMPONENT 1
    Atcc43587
    ChainsA
    EC Number3.1.26.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET33B
    Expression System StrainBL21(DE3)ROSETTA
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneRNP1, PF1816
    Organism ScientificPYROCOCCUS FURIOSUS DSM 3638
    Organism Taxid186497
    StrainDSM3638 / JCM 8422 / VC1
    SynonymRNASE P COMPONENT 1
 
Molecule 2 - RIBONUCLEASE P PROTEIN COMPONENT 4
    Atcc43587
    ChainsB
    EC Number3.1.26.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET33B
    Expression System StrainBL21(DE3)ROSETTA
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneRNP4, PF1613
    Organism ScientificPYROCOCCUS FURIOSUS DSM 3638
    Organism Taxid186497
    StrainDSM3638 / JCM 8422 / VC1
    SynonymRNASE P COMPONENT 4

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1ZN1Ligand/IonZINC ION

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS B:63 , CYS B:66 , CYS B:92 , CYS B:95BINDING SITE FOR RESIDUE ZN B 124

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KI7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KI7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KI7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KI7)

(-) Exons   (0, 0)

(no "Exon" information available for 2KI7)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with RNP1_PYRFU | Q8U007 from UniProtKB/Swiss-Prot  Length:127

    Alignment length:111
                                    26        36        46        56        66        76        86        96       106       116       126 
           RNP1_PYRFU    17 QGSYQEIIGRTWIFRGAHRGRVNKKNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAGENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKKRWRK 127
               SCOP domains --------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------UPF0086-2ki7A01 A:37-124                                                                --- Pfam domains
         Sec.struct. author .........hhhhhhh......hhhhhh.......eeeeeee.......eeeeeeeee..eeeeee..eeee.....eeeeeee...ee..ee......hhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 2ki7 A  17 QGSYQEIIGRTWIFRGAHRGRVNKKNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAGENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKKRWRK 127
                                    26        36        46        56        66        76        86        96       106       116       126 

Chain B from PDB  Type:PROTEIN  Length:97
 aligned with RNP4_PYRFU | Q8U0H6 from UniProtKB/Swiss-Prot  Length:117

    Alignment length:97
                                    18        28        38        48        58        68        78        88        98       
           RNP4_PYRFU     9 EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK 105
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------Rpr2-2ki7B01 B:16-97                                                              -------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh..............eeeeee.....eeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2ki7 B   9 EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK 105
                                    18        28        38        48        58        68        78        88        98       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KI7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KI7)

(-) Pfam Domains  (2, 2)

NMR Structure

(-) Gene Ontology  (18, 27)

NMR Structure(hide GO term definitions)
Chain A   (RNP1_PYRFU | Q8U007)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0004540    ribonuclease activity    Catalysis of the hydrolysis of phosphodiester bonds in chains of RNA.
biological process
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0006379    mRNA cleavage    Any process in which a pre-mRNA or mRNA molecule is cleaved at specific sites or in a regulated manner.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0000172    ribonuclease MRP complex    A ribonucleoprotein complex that contains an RNA molecule of the snoRNA family, and cleaves the rRNA precursor as part of rRNA transcript processing. It also has other roles: In S. cerevisiae it is involved in cell cycle-regulated degradation of daughter cell-specific mRNAs, while in mammalian cells it also enters the mitochondria and processes RNAs to create RNA primers for DNA replication.
    GO:0030677    ribonuclease P complex    A ribonucleoprotein complex that catalyzes cleavage of the leader sequence of precursor tRNAs (pre-tRNAs), generating the mature 5' end of tRNAs.

Chain B   (RNP4_PYRFU | Q8U0H6)
molecular function
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0004526    ribonuclease P activity    Catalysis of the endonucleolytic cleavage of RNA, removing 5' extra nucleotides from tRNA precursor.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0090501    RNA phosphodiester bond hydrolysis    The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0001682    tRNA 5'-leader removal    Generation of the mature 5'-end of the tRNA, usually via an endonucleolytic cleavage by RNase P.
    GO:0008033    tRNA processing    The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030677    ribonuclease P complex    A ribonucleoprotein complex that catalyzes cleavage of the leader sequence of precursor tRNAs (pre-tRNAs), generating the mature 5' end of tRNAs.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ki7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ki7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RNP1_PYRFU | Q8U007
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RNP4_PYRFU | Q8U0H6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.26.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RNP1_PYRFU | Q8U007
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RNP4_PYRFU | Q8U0H6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RNP4_PYRFU | Q8U0H62k3r

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KI7)