|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2KGO) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KGO) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KGO) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2KGO) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:88 aligned with YBII_ECOLI | P41039 from UniProtKB/Swiss-Prot Length:88 Alignment length:88 10 20 30 40 50 60 70 80 YBII_ECOLI 1 MASGWANDDAVNEQINSTIEDAIARARGEIPRGESLDECEECGAPIPQARREAIPGVRLCIHCQQEKDLQKPAYTGYNRRGSKDSQLR 88 SCOP domains ---------------------------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------zf-dskA_traR-2kgoA01 A:51-89 ------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----ZF_DKSA_2 PDB: A:25-96 UniProt: 5-76 ------------ PROSITE (1) PROSITE (2) --------------------------------------ZF_DKSA_1 PDB: A:59-83 ------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------- Transcript 2kgo A 21 MASGWANDDAVNEQINSTIEDAIARARGEIPRGESLDECEECGAPIPQARREAIPGVRLCIHCQQEKDLQKPAYTGYNRRGSKDSQLR 108 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KGO) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KGO) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (YBII_ECOLI | P41039)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|