Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF THE OB-FOLD DOMAIN OF HEME CHAPERONE CCME FROM DESULFOVIBRIO VULGARIS. NORTHEAST STRUCTURAL GENOMICS TARGET DVR115G.
 
Authors :  J. M. Aramini, P. Rossi, H. Lee, A. Lemak, H. Wang, E. L. Foote, M. Jiang, R. Xiao, R. Nair, G. V. T. Swapna, T. B. Acton, B. Rost, J. K. Everett, G. T. Montelione, Northeast Structural Genomics Consortium (Nesg)
Date :  29 Dec 08  (Deposition) - 10 Feb 09  (Release) - 10 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Solution Nmr Structure, Heme Chaperone, Cytochrome C Biogenesis, Ob-Fold Domain, Nesg, Psi-2, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. M. Aramini, P. Rossi, H. Lee, A. Lemak, H. Wang, E. L. Foote, M. Jiang, R. Xiao, R. Nair, G. V. T. Swapna, T. B. Acton, B. Rost, J. K. Everett, G. T. Montelione
Solution Nmr Structure Of The Ob-Fold Domain Of Heme Chaperone Ccme From Desulfovibrio Vulgaris. Northeast Structural Genomics Target Dvr115G.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C-TYPE BIOGENESIS PROTEIN CCME
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidDVR115G-21.2
    Expression System StrainBL21(DE3)MGK
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCCME, DVU_1051
    Organism ScientificDESULFOVIBRIO VULGARIS STR. HILDENBOROUGH
    Organism Taxid882

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KCT)

(-) Sites  (0, 0)

(no "Site" information available for 2KCT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KCT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KCT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KCT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KCT)

(-) Exons   (0, 0)

(no "Exon" information available for 2KCT)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:88
 aligned with Q72D78_DESVH | Q72D78 from UniProtKB/TrEMBL  Length:137

    Alignment length:88
                                    52        62        72        82        92       102       112       122        
         Q72D78_DESVH    43 LATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPSK 130
               SCOP domains ---------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------- CATH domains
               Pfam domains -CcmE-2kctA01 A:44-128                                                                -- Pfam domains
         Sec.struct. author ..........eeeeeee.....ee.....eeeeeee.......eeeeeee...........eeeeeeee.....eeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------- Transcript
                 2kct A  43 MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLE 130
                                    52        62        72        82        92       102       112       122        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KCT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KCT)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (Q72D78_DESVH | Q72D78)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0017004    cytochrome complex assembly    The aggregation, arrangement and bonding together of a cytochrome complex. A cytochrome complex is a protein complex in which at least one of the proteins is a cytochrome, i.e. a heme-containing protein involved in catalysis of redox reactions.
    GO:0017003    protein-heme linkage    The covalent linkage of heme and a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kct)
 
  Sites
(no "Sites" information available for 2kct)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kct)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2kct
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q72D78_DESVH | Q72D78
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q72D78_DESVH | Q72D78
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2KCT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KCT)