Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE PROTEIN TM1081
 
Authors :  P. Serrano, M. Geralt, B. Mohanty, B. Pedrini, R. Horst, K. Wuthrich, I. Joint Center For Structural Genomics (Jcsg)
Date :  30 Oct 08  (Deposition) - 25 Nov 08  (Release) - 12 Jan 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Tm1081, Termotoga Marithima, Phosphoprotein, Structural Genomics, Psi-2, Protein Structure Initiative, Joint Center For Structural Genomics, Jcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Serrano, B. Pedrini, M. Geralt, K. Jaudzems, B. Mohanty, R. Horst, T. Herrmann, M. A. Elsliger, I. A. Wilson, K. Wuthrich
Comparison Of Nmr And Crystal Structures Highlights Conformational Isomerism In Protein Active Sites.
Acta Crystallogr. , Sect. F V. 66 1393 2010
PubMed-ID: 20944236  |  Reference-DOI: 10.1107/S1744309110033658

(-) Compounds

Molecule 1 - PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST TM_1081
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: MH4A
    Expression System Strain: ROSSETA
    Expression System Taxid: 562
    Expression System Variant: DE3
    Expression System Vector Type: PLASMID
    Gene: TM_1081
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KA5)

(-) Sites  (0, 0)

(no "Site" information available for 2KA5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KA5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KA5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KA5)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STASPS50801 STAS domain profile.Y1081_THEMA1-110  1A:13-122
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1STASPS50801 STAS domain profile.Y1081_THEMA1-110  1A:13-122

(-) Exons   (0, 0)

(no "Exon" information available for 2KA5)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:125
 aligned with Y1081_THEMA | Q9X0H0 from UniProtKB/Swiss-Prot  Length:113

    Alignment length:125
                                        1                                                                                                                
                                     -  |      8        18        28        38        48        58        68        78        88        98       108     
          Y1081_THEMA     - ------------MFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGVIVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRRK 113
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------STAS-2ka5A01 A:15-118                                                                                   ------- Pfam domains
         Sec.struct. author ...............eee....eee......hhhhhhhhhhhhhhhh......eeeee.......hhhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhh......eee.hhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------STAS  PDB: A:13-122 UniProt: 1-110                                                                            --- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ka5 A   1 MGSDKIHHHHHHMFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGVIVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRRK 125
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2KA5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KA5)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: STAS (15)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Y1081_THEMA | Q9X0H0)
molecular function
    GO:0045152    antisigma factor binding    Interacting selectively and non-covalently with an antisigma factor, a factor which inhibits the ability of the sigma factor to function as a transcriptional initiator.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ka5)
 
  Sites
(no "Sites" information available for 2ka5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ka5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ka5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y1081_THEMA | Q9X0H0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Y1081_THEMA | Q9X0H0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Y1081_THEMA | Q9X0H0: 3f43

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2KA5)