Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE SOLUTION STRUCTURE OF HUMAN MIA40
 
Authors :  S. Ciofi Baffoni, I. Bertini, A. Gallo
Date :  08 May 08  (Deposition) - 10 Feb 09  (Release) - 17 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Alpha-Hairpin Fold, Coiled Coil-Helix-Coiled Coil-Helix Domain, Mitochondrial Oxidase, Protein Import And Folding, Alternative Splicing, Mitochondrion, Protein Transport, Translocation, Transport, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Banci, I. Bertini, C. Cefaro, S. Ciofi-Baffoni, A. Gallo, M. Martinelli, D. P. Sideris, N. Katrakili, K. Tokatlidis
Mia40 Is An Oxidoreductase That Catalyzes Oxidative Protein Folding In Mitochondria.
Nat. Struct. Mol. Biol. V. 16 198 2009
PubMed-ID: 19182799  |  Reference-DOI: 10.1038/NSMB.1553
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MITOCHONDRIAL INTERMEMBRANE SPACE IMPORT AND ASSEMBLY PROTEIN 40
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainORIGAMI-PLYSS
    Expression System VectorPDEST/HIS-MBP
    Expression System Vector TypePLASMID
    GeneCHCHD4, MIA40
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCOILED-COIL-HELIX-COILED-COIL-HELIX DOMAIN- CONTAINING PROTEIN 4

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K3J)

(-) Sites  (0, 0)

(no "Site" information available for 2K3J)

(-) SS Bonds  (2, 2)

NMR Structure
No.Residues
1A:68 -A:101
2A:78 -A:91

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K3J)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K3J)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CHCHPS51808 Coiled coil-helix-coiled coil-helix (CHCH) domain profile.MIA40_HUMAN61-105  1A:65-109

(-) Exons   (0, 0)

(no "Exon" information available for 2K3J)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:65
 aligned with MIA40_HUMAN | Q8N4Q1 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:65
                                    50        60        70        80        90       100     
          MIA40_HUMAN    41 GLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLY 105
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains -----------------------CHCH-2k3jA01 A:68-104                ----- Pfam domains
         Sec.struct. author ............hhhhhhhh...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------CHCH  PDB: A:65-109 UniProt: 61-105           PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 2k3j A  45 GLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLY 109
                                    54        64        74        84        94       104     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2K3J)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2K3J)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: CHCH (11)

(-) Gene Ontology  (10, 10)

NMR Structure(hide GO term definitions)
Chain A   (MIA40_HUMAN | Q8N4Q1)
molecular function
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0015035    protein disulfide oxidoreductase activity    Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
    GO:0051084    'de novo' posttranslational protein folding    The process of assisting in the correct noncovalent folding of newly formed polypeptides or folding intermediates of polypeptides that have exited the ribosome and/or have been stabilized and transferred by other chaperone proteins. This process could involve several cycles of ATP hydrolysis.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0045041    protein import into mitochondrial intermembrane space    The import of proteins into the space between the inner and outer mitochondrial membranes.
    GO:0022417    protein maturation by protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that results in the attainment of the full functional capacity of a protein.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005758    mitochondrial intermembrane space    The region between the inner and outer lipid bilayers of the mitochondrial envelope.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k3j)
 
  Sites
(no "Sites" information available for 2k3j)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k3j)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k3j
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MIA40_HUMAN | Q8N4Q1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MIA40_HUMAN | Q8N4Q1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MIA40_HUMAN | Q8N4Q12l0y

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2K3J)