Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION NMR STRUCTURE OF PEFI (PLASMID-ENCODED FIMBRIAE REGULATORY) PROTEIN FROM SALMONELLA TYPHIMURIUM. NORTHEAST STRUCTURAL GENOMICS TARGET STR82
 
Authors :  J. M. Aramini, P. Rossi, H. Wang, C. Nwosu, K. Cunningham, L-C. Ma, R. Xia M. C. Baran, G. V. T. Swapna, T. B. Acton, B. Rost, G. T. Montelione, Nort Structural Genomics Consortium (Nesg)
Date :  17 Jul 07  (Deposition) - 09 Oct 07  (Release) - 23 Feb 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Solution Nmr Structure, Winged Helix-Turn-Helix, Transcription Regulatory Protein, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. M. Aramini, P. Rossi, J. R. Cort, L. C. Ma, R. Xiao, T. B. Acton, G. T. Montelione
Solution Nmr Structure Of The Plasmid-Encoded Fimbriae Regulatory Protein Pefi From Salmonella Enterica Serovar Typhimurium.
Proteins V. 79 335 2011
PubMed-ID: 20979070  |  Reference-DOI: 10.1002/PROT.22869

(-) Compounds

Molecule 1 - PEFI PROTEIN
    Atcc700720
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21
    Expression System StrainBL21(DE3)MGK
    Expression System Taxid562
    Expression System VectorSTR82-21.1
    Expression System Vector TypePLASMID
    GenePEFI, PSLT013
    Organism ScientificSALMONELLA TYPHIMURIUM LT2
    Organism Taxid99287
    StrainLT2, SGSC1412

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JT1)

(-) Sites  (0, 0)

(no "Site" information available for 2JT1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JT1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JT1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JT1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JT1)

(-) Exons   (0, 0)

(no "Exon" information available for 2JT1)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:71
 aligned with Q04822_SALTM | Q04822 from UniProtKB/TrEMBL  Length:70

    Alignment length:71
                                                                                                70 
                                    10        20        30        40        50        60        70 
          Q04822_SALTM    1 MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLL-  -
               SCOP domains ----------------------------------------------------------------------- SCOP domains
               CATH domains 2jt1A00 A:1-71 'winged helix' repressor DNA binding domain              CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh...eehhhhhhhhh.hhhhhhhhhhhhhhh..eeee........eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  2jt1 A  1 MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLE 71
                                    10        20        30        40        50        60        70 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JT1)

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2JT1)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Q04822_SALTM | Q04822)
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
cellular component
    GO:0009289    pilus    A proteinaceous hair-like appendage on the surface of bacteria ranging from 2-8 nm in diameter.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jt1)
 
  Sites
(no "Sites" information available for 2jt1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jt1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jt1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q04822_SALTM | Q04822
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q04822_SALTM | Q04822
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2JT1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JT1)