|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JT1) |
Sites (0, 0)| (no "Site" information available for 2JT1) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JT1) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JT1) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JT1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JT1) |
Exons (0, 0)| (no "Exon" information available for 2JT1) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with Q04822_SALTM | Q04822 from UniProtKB/TrEMBL Length:70 Alignment length:71 70 10 20 30 40 50 60 70 Q04822_SALTM 1 MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLL- - SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains 2jt1A00 A:1-71 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2jt1 A 1 MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLE 71 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JT1) |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2JT1) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q04822_SALTM | Q04822)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|