Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE N-TERMINAL EXTRACELLULAR DOMAIN OF THE LYMPHOCYTE RECEPTOR CD5 (CD5 DOMAIN 1)
 
Authors :  A. Garza-Garcia, R. Harris, D. Esposito, P. C. Driscoll
Date :  19 Mar 07  (Deposition) - 26 Feb 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (50x)
Keywords :  Cd5, Domain 1, Scavenger Receptor Cysteine Rich, Srcr, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Garza-Garcia, D. Esposito, W. Rieping, R. Harris, C. Briggs, M. H. Brown, P. C. Driscoll
Three-Dimensional Solution Structure And Conformational Plasticity Of The N-Terminal Scavenger Receptor Cysteine-Rich Domain Of Human Cd5
J. Mol. Biol. V. 378 129 2008
PubMed-ID: 18339402  |  Reference-DOI: 10.1016/J.JMB.2008.02.006
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - T-CELL SURFACE GLYCOPROTEIN CD5
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET15B
    Expression System Vector Type: VECTOR
    Fragment: RESIDUES 25-134
    Gene: CD5, LEU1
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: LYMPHOCYTE ANTIGEN T1/LEU- 1

 Structural Features

(-) Chains, Units

  
NMR Structure (50x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JOP)

(-) Sites  (0, 0)

(no "Site" information available for 2JOP)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:44 -A:86
2A:60 -A:125
3A:81 -A:132
4A:107 -A:117

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JOP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JOP)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SRCR_2PS50287 SRCR domain profile.CD5_HUMAN35-133
276-368
159-268		  1A:35-133
-
-

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003477851ENSE00001145405chr11:60869930-60870087158CD5_HUMAN1-19190--
1.2ENST000003477852ENSE00001145421chr11:60882528-6088256639CD5_HUMAN19-32141A:25-328
1.3ENST000003477853ENSE00001145399chr11:60885647-60885952306CD5_HUMAN32-1341031A:32-134103
1.4ENST000003477854ENSE00001119061chr11:60886387-6088644963CD5_HUMAN134-155221A:134-1341
1.5ENST000003477855ENSE00001119062chr11:60886706-60887047342CD5_HUMAN155-2691150--
1.6ENST000003477856ENSE00001145387chr11:60889083-60889376294CD5_HUMAN269-367990--
1.7ENST000003477857ENSE00001145383chr11:60890379-60890504126CD5_HUMAN367-409430--
1.8ENST000003477858ENSE00000721687chr11:60891356-6089140954CD5_HUMAN409-427190--
1.9ENST000003477859ENSE00001198934chr11:60892504-60892623120CD5_HUMAN427-467410--
1.10ENST0000034778510ENSE00001198984chr11:60893223-6089331391CD5_HUMAN467-495290--
1.11ENST0000034778511ENSE00001397719chr11:60893760-608953191560CD5_HUMAN-00--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:110
 aligned with CD5_HUMAN | P06127 from UniProtKB/Swiss-Prot  Length:495

    Alignment length:110
                                    34        44        54        64        74        84        94       104       114       124       134
            CD5_HUMAN    25 RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLE 134
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------SRCR-2jopA01 A:38-133                                                                           - Pfam domains
         Sec.struct. author ..........eee..........eeeee..eeee..................hhhhhhhh.....eeeee..........eee.........eee........eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------SRCR_2  PDB: A:35-133 UniProt: 35-133                                                              - PROSITE
           Transcript 1 (1) Exon 1.2-----------------------------------------------------------------------------------------------------1 Transcript 1 (1)
           Transcript 1 (2) -------Exon 1.3  PDB: A:32-134 UniProt: 32-134                                                                 Transcript 1 (2)
                 2jop A  25 RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGDPLSLGPFLKTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLE 134
                                    34        44        54        64        74        84        94       104       114       124       134
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JOP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JOP)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: SRCR] (5)

(-) Gene Ontology  (14, 14)

NMR Structure(hide GO term definitions)
Chain A   (CD5_HUMAN | P06127)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0005044    scavenger receptor activity    Combining with any modified low-density lipoprotein (LDL) or other polyanionic ligand and delivering the ligand into the cell via endocytosis. Ligands include acetylated and oxidized LDL, Gram-positive and Gram-negative bacteria, apoptotic cells, amyloid-beta fibrils, and advanced glycation end products (AGEs).
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
    GO:0031295    T cell costimulation    The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
    GO:0097190    apoptotic signaling pathway    A series of molecular signals which triggers the apoptotic death of a cell. The pathway starts with reception of a signal, and ends when the execution phase of apoptosis is triggered.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0008037    cell recognition    The process in which a cell in an organism interprets its surroundings.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
cellular component
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jop)
 
  Sites
(no "Sites" information available for 2jop)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jop)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jop
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CD5_HUMAN | P06127
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CD5_HUMAN | P06127
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CD5_HUMAN | P06127: 2ja4 2jp0 2ott

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JOP)