Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE CUL7-CPH DOMAIN FROM HOMO SAPIENS; NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HT1.
 
Authors :  A. Lemak, L. Kaustov, J. Lukin, S. Duan, C. H. Arrowsmith, Northeast Structural Genomics Consortium (Nesg)
Date :  23 Jan 07  (Deposition) - 27 Feb 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  P53 Binding Domain, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Kaustov, J. Lukin, A. Lemak, S. Duan, M. Ho, R. Doherty, L. Z. Penn, C. H. Arrowsmith
The Conserved Cph Domains Of Cul7 And Parc Are Protein-Protein Interaction Modules That Bind The Tetramerization Domain Of P53
J. Biol. Chem. V. 282 11300 2007
PubMed-ID: 17298945  |  Reference-DOI: 10.1074/JBC.M611297200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CULLIN-7
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET 15B
    Expression System Vector TypeVECTOR
    FragmentSEQUENCE DATABASE RESIDUES 360-460
    GeneCUL7, KIAA0076
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCUL-7

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JNG)

(-) Sites  (0, 0)

(no "Site" information available for 2JNG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JNG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JNG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JNG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JNG)

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002653481ENSE00001874867chr6:43021437-4302136078CUL7_HUMAN-00--
1.2ENST000002653482ENSE00000850048chr6:43020534-43019947588CUL7_HUMAN1-1941940--
1.3ENST000002653483ENSE00000751724chr6:43019501-43019350152CUL7_HUMAN194-244510--
1.4ENST000002653484ENSE00000518395chr6:43019206-43018706501CUL7_HUMAN245-4111671A:4-5653
1.5ENST000002653485ENSE00000751717chr6:43018136-43017998139CUL7_HUMAN412-458471A:57-8024
1.6ENST000002653486ENSE00000518397chr6:43017897-43017701197CUL7_HUMAN458-523660--
1.7ENST000002653487ENSE00000751715chr6:43017400-43017145256CUL7_HUMAN524-609860--
1.8ENST000002653488ENSE00000518399chr6:43016307-43016070238CUL7_HUMAN609-688800--
1.9aENST000002653489aENSE00000850047chr6:43015991-43015886106CUL7_HUMAN688-723360--
1.11ENST0000026534811ENSE00002146640chr6:43014845-43014618228CUL7_HUMAN724-799760--
1.12ENST0000026534812ENSE00002193479chr6:43014339-4301424991CUL7_HUMAN800-830310--
1.13ENST0000026534813ENSE00002168992chr6:43014145-43013974172CUL7_HUMAN830-887580--
1.14ENST0000026534814ENSE00002193547chr6:43013829-43013724106CUL7_HUMAN887-922360--
1.15ENST0000026534815ENSE00002176201chr6:43013420-4301332596CUL7_HUMAN923-954320--
1.16ENST0000026534816ENSE00000751563chr6:43013140-43012965176CUL7_HUMAN955-1013590--
1.17ENST0000026534817ENSE00002150252chr6:43012623-43012490134CUL7_HUMAN1013-1058460--
1.18ENST0000026534818ENSE00000751557chr6:43011368-43011186183CUL7_HUMAN1058-1119620--
1.19ENST0000026534819ENSE00000518410chr6:43010918-43010812107CUL7_HUMAN1119-1154360--
1.20ENST0000026534820ENSE00000518411chr6:43010722-43010540183CUL7_HUMAN1155-1215610--
1.21ENST0000026534821ENSE00000518412chr6:43008813-43008653161CUL7_HUMAN1216-1269540--
1.22ENST0000026534822ENSE00000751549chr6:43008484-43008268217CUL7_HUMAN1269-1341730--
1.23ENST0000026534823ENSE00000751547chr6:43008164-43007894271CUL7_HUMAN1342-1432910--
1.24ENST0000026534824ENSE00000518415chr6:43006725-43006580146CUL7_HUMAN1432-1480490--
1.25ENST0000026534825ENSE00000751543chr6:43006430-43006304127CUL7_HUMAN1481-1523430--
1.26ENST0000026534826ENSE00000850042chr6:43006210-43006005206CUL7_HUMAN1523-1591690--
1.27ENST0000026534827ENSE00000850041chr6:43005749-43005355395CUL7_HUMAN1592-16981070--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:77
 aligned with CUL7_HUMAN | Q14999 from UniProtKB/Swiss-Prot  Length:1698

    Alignment length:77
                                   368       378       388       398       408       418       428       
           CUL7_HUMAN   359 PRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE 435
               SCOP domains -d2jnga1 A:5-80 Cullin-7                                                      SCOP domains
               CATH domains 2jngA00 A:4-80  [code=2.30.30.30, no name defined]                            CATH domains
               Pfam domains -Cul7-2jngA01 A:5-80                                                          Pfam domains
         Sec.struct. author hhhhh..hhhhhhhhhhhh....eeee...........eeeeeee.....eeeeee....eeeeee...eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4  PDB: A:4-56 UniProt: 245-411 [INCOMPLETE]  Exon 1.5  PDB: A:57-80   Transcript 1
                 2jng A   4 MRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE  80
                                    13        23        33        43        53        63        73       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (27, 27)

NMR Structure(hide GO term definitions)
Chain A   (CUL7_HUMAN | Q14999)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0007030    Golgi organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the Golgi apparatus.
    GO:0036498    IRE1-mediated unfolded protein response    A series of molecular signals mediated by the endoplasmic reticulum stress sensor IRE1 (Inositol-requiring transmembrane kinase/endonuclease). Begins with activation of IRE1 in response to endoplasmic reticulum (ER) stress, and ends with regulation of a downstream cellular process, e.g. transcription. One target of activated IRE1 is the transcription factor HAC1 in yeast, or XBP1 in mammals; IRE1 cleaves an intron of a mRNA coding for HAC1/XBP1 to generate an activated HAC1/XBP1 transcription factor, which controls the up regulation of UPR-related genes. At least in mammals, IRE1 can also signal through additional intracellular pathways including JNK and NF-kappaB.
    GO:0001837    epithelial to mesenchymal transition    A transition where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0000226    microtubule cytoskeleton organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising microtubules and their associated proteins.
    GO:0000281    mitotic cytokinesis    A cell cycle process that results in the division of the cytoplasm of a cell after mitosis, resulting in the separation of the original cell into two daughter cells.
    GO:0001890    placenta development    The process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
    GO:0050775    positive regulation of dendrite morphogenesis    Any process that activates or increases the frequency, rate or extent of dendrite morphogenesis.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0007088    regulation of mitotic nuclear division    Any process that modulates the frequency, rate or extent of mitosis.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
    GO:0001570    vasculogenesis    The differentiation of endothelial cells from progenitor cells during blood vessel development, and the de novo formation of blood vessels and tubes.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:1990393    3M complex    A protein complex, at least composed of CUL7, CCDC8 and OBSL1, that is required for maintaining microtubule and genome integrity.
    GO:0031467    Cul7-RING ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul7 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 linker and an F-box protein.
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005680    anaphase-promoting complex    A ubiquitin ligase complex that degrades mitotic cyclins and anaphase inhibitory protein, thereby triggering sister chromatid separation and exit from mitosis. Substrate recognition by APC occurs through degradation signals, the most common of which is termed the Dbox degradation motif, originally discovered in cyclin B.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jng)
 
  Sites
(no "Sites" information available for 2jng)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jng)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jng
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CUL7_HUMAN | Q14999
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CUL7_HUMAN | Q14999
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2JNG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JNG)