|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2JNE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JNE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JNE) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JNE) |
Exons (0, 0)| (no "Exon" information available for 2JNE) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with YFGJ_ECOLI | P76575 from UniProtKB/Swiss-Prot Length:71 Alignment length:71 10 20 30 40 50 60 70 YFGJ_ECOLI 1 MELHCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAVDYFCQHGHGLISKKRVEFVLA 71 SCOP domains d2jnea1 A:1-71 Hypothetical protein YfgJ SCOP domains CATH domains 2jneA00 A:1-71 YfgJ-like CATH domains Pfam domains -DUF1407-2jneA01 A:2-71 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2jne A 1 MELHCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAVDYFCQHGHGLISKKRVEFVLA 71 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JNE)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|