2JGN - JenaLib

Asymmetric Unit (9, 25)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_075741	Q	417	P	DDX3X_HUMAN	Disease (MRX102)	796052233	A/B/C	Q	416	P
2	UniProt	VAR_075742	R	475	G	DDX3X_HUMAN	Disease (MRX102)	---	B/C	R	474	G
3	UniProt	VAR_075743	R	480	S	DDX3X_HUMAN	Disease (MRX102)	---	B/C	R	479	S
4	UniProt	VAR_075744	R	488	H	DDX3X_HUMAN	Disease (MRX102)	796052235	A/B/C	R	487	H
5	UniProt	VAR_075745	I	507	T	DDX3X_HUMAN	Disease (MRX102)	797045024	A/B/C	I	506	T
6	UniProt	VAR_075746	N	509	I	DDX3X_HUMAN	Disease (MRX102)	---	A/B/C	N	508	I
7	UniProt	VAR_075747	I	514	T	DDX3X_HUMAN	Disease (MRX102)	796052226	A/B/C	I	513	T
8	UniProt	VAR_075748	R	534	H	DDX3X_HUMAN	Disease (MRX102)	---	A/B/C	R	533	H
9	UniProt	VAR_075750	P	568	L	DDX3X_HUMAN	Disease (MRX102)	---	A/B/C	P	567	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_075741	Q	417	P	DDX3X_HUMAN	Disease (MRX102)	796052233	A	Q	416	P
4	UniProt	VAR_075744	R	488	H	DDX3X_HUMAN	Disease (MRX102)	796052235	A	R	487	H
5	UniProt	VAR_075745	I	507	T	DDX3X_HUMAN	Disease (MRX102)	797045024	A	I	506	T
6	UniProt	VAR_075746	N	509	I	DDX3X_HUMAN	Disease (MRX102)	---	A	N	508	I
7	UniProt	VAR_075747	I	514	T	DDX3X_HUMAN	Disease (MRX102)	796052226	A	I	513	T
8	UniProt	VAR_075748	R	534	H	DDX3X_HUMAN	Disease (MRX102)	---	A	R	533	H
9	UniProt	VAR_075750	P	568	L	DDX3X_HUMAN	Disease (MRX102)	---	A	P	567	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_075741	Q	417	P	DDX3X_HUMAN	Disease (MRX102)	796052233	B	Q	416	P
2	UniProt	VAR_075742	R	475	G	DDX3X_HUMAN	Disease (MRX102)	---	B	R	474	G
3	UniProt	VAR_075743	R	480	S	DDX3X_HUMAN	Disease (MRX102)	---	B	R	479	S
4	UniProt	VAR_075744	R	488	H	DDX3X_HUMAN	Disease (MRX102)	796052235	B	R	487	H
5	UniProt	VAR_075745	I	507	T	DDX3X_HUMAN	Disease (MRX102)	797045024	B	I	506	T
6	UniProt	VAR_075746	N	509	I	DDX3X_HUMAN	Disease (MRX102)	---	B	N	508	I
7	UniProt	VAR_075747	I	514	T	DDX3X_HUMAN	Disease (MRX102)	796052226	B	I	513	T
8	UniProt	VAR_075748	R	534	H	DDX3X_HUMAN	Disease (MRX102)	---	B	R	533	H
9	UniProt	VAR_075750	P	568	L	DDX3X_HUMAN	Disease (MRX102)	---	B	P	567	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_075741	Q	417	P	DDX3X_HUMAN	Disease (MRX102)	796052233	C	Q	416	P
2	UniProt	VAR_075742	R	475	G	DDX3X_HUMAN	Disease (MRX102)	---	C	R	474	G
3	UniProt	VAR_075743	R	480	S	DDX3X_HUMAN	Disease (MRX102)	---	C	R	479	S
4	UniProt	VAR_075744	R	488	H	DDX3X_HUMAN	Disease (MRX102)	796052235	C	R	487	H
5	UniProt	VAR_075745	I	507	T	DDX3X_HUMAN	Disease (MRX102)	797045024	C	I	506	T
6	UniProt	VAR_075746	N	509	I	DDX3X_HUMAN	Disease (MRX102)	---	C	N	508	I
7	UniProt	VAR_075747	I	514	T	DDX3X_HUMAN	Disease (MRX102)	796052226	C	I	513	T
8	UniProt	VAR_075748	R	534	H	DDX3X_HUMAN	Disease (MRX102)	---	C	R	533	H
9	UniProt	VAR_075750	P	568	L	DDX3X_HUMAN	Disease (MRX102)	---	C	P	567	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (4, 12)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:151
 aligned with DDX3X_HUMAN | O00571 from UniProtKB/Swiss-Prot  Length:662

    Alignment length:166
                                   420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570      
          DDX3X_HUMAN   411 TSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY 576
               SCOP domains d2jgna_ A: automated matches                                                                                                                                           SCOP domains
               CATH domains 2jgnA00 A:410-575 P-loop con taining nucleotide triphosphate h        ydrolases                                                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.hhhhhhhhhhhhhhhh-....eeeee.hhhhhhhhhhhhhhh...eeee.--------hhhhhhhhh....eeeee.------......eeee.....hhhhhhhhhh........eeeeeeehhhhhhhhhhhhhhhhhh....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------P----------------------------------------------------------------------H------------------T-I----T-------------------H---------------------------------L-------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.14b  PDB: A:410-437   ------------------------------------------------------------Exon 1.16  PDB: A:505-538 [INCOMPLETE]  ------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------Exon 1.15  PDB: A:439-498 (gaps) UniProt: 439-499            ---------------------------------------Exon 1.17b  PDB: A:538-575             Transcript 1 (2)
                 2jgn A 410 TSENITQKVVWVEESDKRSFLLDLLNAT-KDSLTLVFVETKKGADSLEDFLYHEGYACTSIH--------EEALHQFRSGKSPILVATA------DISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY 575
                                   419       429       439       449       459       469 |       -|      489        |-     | 509       519       529       539       549       559       569      
                                                     437 |                             471      480               498    505                                                                      
                                                       439

Chain B from PDB  Type:PROTEIN  Length:161
 aligned with DDX3X_HUMAN | O00571 from UniProtKB/Swiss-Prot  Length:662

    Alignment length:168
                                   418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568        
          DDX3X_HUMAN   409 GSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY 576
               SCOP domains d2jgnb_ B: automated matches                                                                                                                                             SCOP domains
               CATH domains 2jgnB00 B:408-575 P-loop contai  ning nucleotide triphosphate hydrolases                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeee.hhhhhhhhhhhhhhhhh--..eeeee.hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhh....eeeee...-----.....eeee.....hhhhhhhhhh........eeeeeeehhhhhhhhhhhhhhhhhh....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------P---------------------------------------------------------G----S-------H------------------T-I----T-------------------H---------------------------------L-------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.14b  PDB: B:408-438     ------------------------------------------------------------Exon 1.16  PDB: B:499-538 (gaps)        ------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------Exon 1.15  PDB: B:438-498 (gaps) UniProt: 439-499            ---------------------------------------Exon 1.17b  PDB: B:538-575             Transcript 1 (2)
                 2jgn B 408 GSTSENITQKVVWVEESDKRSFLLDLLNATG--SLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVA-----ISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY 575
                                   417       427       437|  |   447       457       467       477       487       497  |    507       517       527       537       547       557       567        
                                                        438  |                                                        500   506                                                                     
                                                           441

Chain C from PDB  Type:PROTEIN  Length:158
 aligned with DDX3X_HUMAN | O00571 from UniProtKB/Swiss-Prot  Length:662

    Alignment length:164
                                   421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571    
          DDX3X_HUMAN   412 SENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMA 575
               SCOP domains d2jgnc_ C: automated matc he  s                                                                                                                                      SCOP domains
               CATH domains 2jgnC00 C:411-574 P-loop  co  ntaining nucleotide triphosphate hy   drolases                                                                                         CATH domains
           Pfam domains (1) ------------------------- --  -----------------Helicase_C-2jgnC01    C:458-535                                               --------------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------- --  -----------------Helicase_C-2jgnC02    C:458-535                                               --------------------------------------- Pfam domains (2)
           Pfam domains (3) ------------------------- --  -----------------Helicase_C-2jgnC03    C:458-535                                               --------------------------------------- Pfam domains (3)
         Sec.struct. author ...eeeeeee.hhhhhhhhhhhhhh-..--..eeeee.hhhhhhhhhhhhhhh...eeee.....---hhhhhhhhhh....eeeee.............eeee.....hhhhhhhhhh........eeeeeeehhhhhhhhhhhhhhhhhh....hhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----P---------------------------------------------------------G----S-------H------------------T-I----T-------------------H---------------------------------L------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.14b UniProt: 391-439 ------------------------------------------------------------Exon 1.16  PDB: C:499-538               ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.15  PDB: C:438-498 (gaps) UniProt: 439-499            ---------------------------------------Exon 1.17b  PDB: C:538-574            Transcript 1 (2)
                 2jgn C 411 SENITQKVVWVEESDKRSFLLDLLN-TG--SLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRS---REEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMA 574
                                   420       430    | || -|      450       460       470    |  480       490       500       510       520       530       540       550       560       570    
                                                  435 ||  |                               475 479                                                                                               
                                                    437|  |                                                                                                                                     
                                                     438  |                                                                                                                                     
                                                        441

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (69, 69)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (DDX3X_HUMAN | O00571)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004003	ATP-dependent DNA helicase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction drives the unwinding of the DNA helix.
	GO:0004004	ATP-dependent RNA helicase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction drives the unwinding of an RNA helix.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0043273	CTPase activity	Catalysis of the reaction: CTP + H2O = CDP + phosphate. May or may not be coupled to another reaction.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0035613	RNA stem-loop binding	Interacting selectively and non-covalently with a stem-loop in an RNA molecule. An RNA stem-loop is a secondary RNA structure consisting of a double-stranded RNA (dsRNA) stem and a terminal loop.
	GO:0008190	eukaryotic initiation factor 4E binding	Interacting selectively and non-covalently with eukaryotic initiation factor 4E, a polypeptide factor involved in the initiation of ribosome-mediated translation.
	GO:0004386	helicase activity	Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0048027	mRNA 5'-UTR binding	Interacting selectively and non-covalently with the 5' untranslated region of an mRNA molecule.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0017111	nucleoside-triphosphatase activity	Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0008143	poly(A) binding	Interacting selectively and non-covalently with a sequence of adenylyl residues in an RNA molecule, such as the poly(A) tail, a sequence of adenylyl residues at the 3' end of eukaryotic mRNA.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043024	ribosomal small subunit binding	Interacting selectively and non-covalently with any part of the small ribosomal subunit.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0031369	translation initiation factor binding	Interacting selectively and non-covalently with a translation initiation factor, any polypeptide factor involved in the initiation of ribosome-mediated translation.
biological process
	GO:0032508	DNA duplex unwinding	The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
	GO:0010501	RNA secondary structure unwinding	The process in which a secondary structure of RNA are broken or 'melted'.
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0071243	cellular response to arsenic-containing substance	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an arsenic stimulus from compounds containing arsenic, including arsenates, arsenites, and arsenides.
	GO:0071470	cellular response to osmotic stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of solutes outside the organism or cell.
	GO:0007059	chromosome segregation	The process in which genetic material, in the form of chromosomes, is organized into specific structures and then physically separated and apportioned to two or more sets. In eukaryotes, chromosome segregation begins with the condensation of chromosomes, includes chromosome separation, and ends when chromosomes have completed movement to the spindle poles.
	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with a ligand binding to a death domain receptor on the cell surface, and ends when the execution phase of apoptosis is triggered.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0097193	intrinsic apoptotic signaling pathway	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway starts with reception of an intracellular signal (e.g. DNA damage, endoplasmic reticulum stress, oxidative stress etc.), and ends when the execution phase of apoptosis is triggered. The intrinsic apoptotic signaling pathway is crucially regulated by permeabilization of the mitochondrial outer membrane (MOMP).
	GO:0042256	mature ribosome assembly	The aggregation, arrangement and bonding together of the large and small ribosomal subunits into a functional ribosome.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
	GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of intrinsic apoptotic signaling pathway.
	GO:0031333	negative regulation of protein complex assembly	Any process that stops, prevents, or reduces the frequency, rate or extent of protein complex assembly.
	GO:0017148	negative regulation of translation	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that promotes the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0030307	positive regulation of cell growth	Any process that activates or increases the frequency, rate, extent or direction of cell growth.
	GO:0071651	positive regulation of chemokine (C-C motif) ligand 5 production	Any process that activates or increases the frequency, rate, or extent of production of chemokine (C-C motif) ligand 5.
	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that activates or increases the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0032728	positive regulation of interferon-beta production	Any process that activates or increases the frequency, rate, or extent of interferon-beta production.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045727	positive regulation of translation	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0045948	positive regulation of translational initiation	Any process that activates or increases the frequency, rate or extent of translational initiation.
	GO:0045070	positive regulation of viral genome replication	Any process that activates or increases the frequency, rate or extent of viral genome replication.
	GO:1903608	protein localization to cytoplasmic stress granule	A process in which a protein is transported to, or maintained in, a location within a cytoplasmic stress granule.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006417	regulation of translation	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0042254	ribosome biogenesis	A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
	GO:0034063	stress granule assembly	The aggregation, arrangement and bonding together of proteins and RNA molecules to form a stress granule.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0010494	cytoplasmic stress granule	A dense aggregation in the cytosol composed of proteins and RNAs that appear when the cell is under stress.
	GO:0022627	cytosolic small ribosomal subunit	The small subunit of a ribosome located in the cytosol.
	GO:0005852	eukaryotic translation initiation factor 3 complex	A complex of several polypeptides that plays at least two important roles in protein synthesis: First, eIF3 binds to the 40S ribosome and facilitates loading of the Met-tRNA/eIF2.GTP ternary complex to form the 43S preinitiation complex. Subsequently, eIF3 apparently assists eIF4 in recruiting mRNAs to the 43S complex. The eIF3 complex contains five conserved core subunits, and may contain several additional proteins; the non-core subunits are thought to mediate association of the complex with specific sets of mRNAs.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005741	mitochondrial outer membrane	The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0016607	nuclear speck	A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 25)

PROSITE Motifs (0, 0)

Exons (4, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (69, 69)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File