2IQW - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Title :   MODEL OF MELANOCORTIN-4 RECEPTOR WITH ASIP

Authors :   I. D. Pogozheva

Date :   14 Oct 06 (Deposition) - 24 Oct 06 (Release) - 24 Oct 06 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A,B

Keywords :   G Protein-Coupled Receptor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. X. Chai, I. D. Pogozheva, Y-M. Lai, R. R. Neubig, H. I. Mosberg, I. Gantz
Receptor-Antagonist Interactions In The Complexes Of Agouti And Agouti-Related Protein With Human Melanocortin 1 And 4 Receptors
Biochemistry V. 44 3418 2005
PubMed: search
(for further references see the PDB file header)

Molecule 1 - MELANOCORTIN-4 RECEPTOR
	Chains	:	A
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS

Molecule 2 - AGOUTI SIGNALING PROTEIN
	Chains	:	B
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2IQW)

(no "Site" information available for 2IQW)

Theoretical Model

No.	Residues
1	A:40	-	A:279
2	A:271	-	A:277
3	B:93	-	B:108
4	B:100	-	B:114
5	B:107	-	B:125
6	B:111	-	B:132
7	B:116	-	B:123

(no "Cis Peptide Bond" information available for 2IQW)

Theoretical Model (28, 28)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_038634	V	50	M	MC4R_HUMAN	Disease (OBESITY)	121913557	A	V	50	M
02	UniProt	VAR_038635	S	58	C	MC4R_HUMAN	Disease (OBESITY)	121913558	A	S	58	C
03	UniProt	VAR_038636	N	62	S	MC4R_HUMAN	Disease (OBESITY)	121913566	A	N	62	S
04	UniProt	VAR_077570	N	72	K	MC4R_HUMAN	Disease	---	A	N	72	K
05	UniProt	VAR_010706	P	78	L	MC4R_HUMAN	Disease (OBESITY)	13447326	A	P	78	L
06	UniProt	VAR_038638	N	97	D	MC4R_HUMAN	Disease (OBESITY)	121913565	A	N	97	D
07	UniProt	VAR_038639	I	102	S	MC4R_HUMAN	Disease (OBESITY)	121913559	A	I	102	S
08	UniProt	VAR_038640	I	102	T	MC4R_HUMAN	Disease (OBESITY)	121913559	A	I	102	T
09	UniProt	VAR_010707	V	103	I	MC4R_HUMAN	Polymorphism	2229616	A	I	103	I
10	UniProt	VAR_038641	L	106	P	MC4R_HUMAN	Disease (OBESITY)	---	A	L	106	P
11	UniProt	VAR_010708	T	112	M	MC4R_HUMAN	Polymorphism	13447329	A	T	112	M
12	UniProt	VAR_038642	I	125	K	MC4R_HUMAN	Disease (OBESITY)	---	A	I	125	K
13	UniProt	VAR_038643	S	127	L	MC4R_HUMAN	Disease (OBESITY)	13447331	A	S	127	L
14	UniProt	VAR_038644	R	165	Q	MC4R_HUMAN	Disease (OBESITY)	13447332	A	R	165	Q
15	UniProt	VAR_010709	R	165	W	MC4R_HUMAN	Disease (OBESITY)	13447332	A	R	165	W
16	UniProt	VAR_038645	I	170	V	MC4R_HUMAN	Disease (OBESITY)	121913560	A	I	170	V
17	UniProt	VAR_038646	A	175	T	MC4R_HUMAN	Disease (OBESITY)	121913563	A	A	175	T
18	UniProt	VAR_038647	G	181	D	MC4R_HUMAN	Disease (OBESITY)	13447333	A	G	181	D
19	UniProt	VAR_038648	A	219	V	MC4R_HUMAN	Disease (OBESITY)	121913567	A	A	219	V
20	UniProt	VAR_038649	I	226	T	MC4R_HUMAN	Polymorphism	193922686	A	I	226	T
21	UniProt	VAR_010710	I	251	L	MC4R_HUMAN	Polymorphism	52820871	A	I	251	L
22	UniProt	VAR_010711	G	252	S	MC4R_HUMAN	Disease (OBESITY)	13447336	A	G	252	S
23	UniProt	VAR_038650	V	253	I	MC4R_HUMAN	Disease (OBESITY)	187152753	A	V	253	I
24	UniProt	VAR_038651	C	271	R	MC4R_HUMAN	Disease (OBESITY)	---	A	C	271	R
25	UniProt	VAR_038652	C	271	Y	MC4R_HUMAN	Disease (OBESITY)	121913562	A	C	271	Y
26	UniProt	VAR_015357	N	274	S	MC4R_HUMAN	Disease (OBESITY)	121913561	A	N	274	S
27	UniProt	VAR_038653	I	316	S	MC4R_HUMAN	Disease (OBESITY)	121913564	A	I	316	S
28	UniProt	VAR_010712	I	317	T	MC4R_HUMAN	Disease (OBESITY)	13447337	A	I	317	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (3, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	AGOUTI_1	PS60024	Agouti domain signature.	ASIP_HUMAN	93-132	1	B:93-132
2	AGOUTI_2	PS51150	Agouti domain profile.	ASIP_HUMAN	93-132	1	B:93-132
3	G_PROTEIN_RECEP_F1_1	PS00237	G-protein coupled receptors family 1 signature.	MC4R_HUMAN	135-151	1	A:135-151

Theoretical Model (2, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000299766	1	ENSE00001104613	chr18:58040001-58038564	1438	MC4R_HUMAN	1-472	472	1	A:40-321	282

2.1	ENST00000374954	1	ENSE00001465251	chr20:32848171-32848340	170	ASIP_HUMAN	1-54	54	0	-	-
2.2	ENST00000374954	2	ENSE00000661381	chr20:32850638-32850699	62	ASIP_HUMAN	54-74	21	0	-	-
2.3	ENST00000374954	3	ENSE00001465248	chr20:32856797-32857150	354	ASIP_HUMAN	75-132	58	1	B:93-132	40

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:282
 aligned with MC4R_HUMAN | P32245 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:282
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319  
           MC4R_HUMAN    40 CYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYP 321
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ----------M-------C---S---------K-----L------------------D----SI--P-----M------------K-L-------------------------------------Q----V----T-----D-------------------------------------V------T------------------------LSI-----------------R--S-----------------------------------------ST---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------------T--------------------------------------------------------------W---------------------------------------------------------------------------------------------------------Y-------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -----------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:40-321 UniProt: 1-472 [INCOMPLETE]                                                                                                                                                                                                                                        Transcript 1
                 2iqw A  40 CYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIIITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYP 321
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319

Chain B from PDB  Type:PROTEIN  Length:40
 aligned with ASIP_HUMAN | P42127 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:40
                                   102       112       122       132
           ASIP_HUMAN    93 CVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC 132
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ....................eeee......eeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                PROSITE (1) AGOUTI_2  PDB: B:93-132 UniProt: 93-132  PROSITE (1)
                PROSITE (2) AGOUTI_1  PDB: B:93-132 UniProt: 93-132  PROSITE (2)
               Transcript 2 Exon 2.3  PDB: B:93-132 UniProt: 75-132  Transcript 2
                 2iqw B  93 CVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC 132
                                   102       112       122       132

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2IQW)

(no "CATH Domain" information available for 2IQW)

(no "Pfam Domain" information available for 2IQW)

Theoretical Model(hide GO term definitions)

Chain A (MC4R_HUMAN | P32245)

molecular function
	GO:0004930	G-protein coupled receptor activity	Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
	GO:0004977	melanocortin receptor activity	Combining with melanocortin to initiate a change in cell activity.
	GO:0004980	melanocyte-stimulating hormone receptor activity	Combining with melanocyte-stimulating hormone to initiate a change in cell activity.
	GO:0042923	neuropeptide binding	Interacting selectively and non-covalently and stoichiometrically with neuropeptides, peptides with direct synaptic effects (peptide neurotransmitters) or indirect modulatory effects on the nervous system (peptide neuromodulators).
	GO:0017046	peptide hormone binding	Interacting selectively and non-covalently with any peptide with hormonal activity in animals.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation or inhibition of adenylyl cyclase activity and a subsequent change in the concentration of cyclic AMP (cAMP).
	GO:0002024	diet induced thermogenesis	The process that results in increased metabolic rate in tissues of an organism. It is triggered by the detection of dietary excess. This process is achieved via signalling in the sympathetic nervous system.
	GO:0006112	energy reserve metabolic process	The chemical reactions and pathways by which a cell derives energy from stored compounds such as fats or glycogen.
	GO:0007631	feeding behavior	Behavior associated with the intake of food.
	GO:0030073	insulin secretion	The regulated release of proinsulin from secretory granules (B granules) in the B cells of the pancreas; accompanied by cleavage of proinsulin to form mature insulin.
	GO:2000252	negative regulation of feeding behavior	Any process that stops, prevents or reduces the frequency, rate or extent of feeding behavior.
	GO:0045780	positive regulation of bone resorption	Any process that activates or increases the frequency, rate or extent of bone resorption.
	GO:0030819	positive regulation of cAMP biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
	GO:0060259	regulation of feeding behavior	Any process that modulates the rate, frequency or extent of the behavior associated with the intake of food.
	GO:2000821	regulation of grooming behavior	Any process that modulates the frequency, rate or extent of grooming behavior.
	GO:0019222	regulation of metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways within a cell or an organism.
	GO:0032868	response to insulin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (ASIP_HUMAN | P42127)

molecular function
	GO:0031779	melanocortin receptor binding	Interacting selectively and non-covalently with a melanocortin receptor.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0031781	type 3 melanocortin receptor binding	Interacting selectively and non-covalently with a type 3 melanocortin receptor.
	GO:0031782	type 4 melanocortin receptor binding	Interacting selectively and non-covalently with a type 4 melanocortin receptor.
biological process
	GO:0008343	adult feeding behavior	Feeding behavior in a fully developed and mature organism.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0006091	generation of precursor metabolites and energy	The chemical reactions and pathways resulting in the formation of precursor metabolites, substances from which energy is derived, and any process involved in the liberation of energy from these substances.
	GO:0071514	genetic imprinting	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving macromolecules by a mechanism that is mediated by DNA, is mitotically or meiotically heritable, or is stably self-propagated in the cytoplasm of a resting cell, and does not entail a change in DNA sequence.
	GO:0009755	hormone-mediated signaling pathway	A series of molecular signals mediated by the detection of a hormone.
	GO:0042438	melanin biosynthetic process	The chemical reactions and pathways resulting in the formation of melanins, pigments largely of animal origin. High molecular weight polymers of indole quinone, they are irregular polymeric structures and are divided into three groups: allomelanins in the plant kingdom and eumelanins and phaeomelanins in the animal kingdom.
	GO:0032438	melanosome organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a melanosome. A melanosome is a tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored.
	GO:0032402	melanosome transport	The directed movement of melanosomes into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0043473	pigmentation	The accumulation of pigment in an organism, tissue or cell, either by increased deposition or by increased number of cells.
	GO:0048023	positive regulation of melanin biosynthetic process	Any process that activates or increases the rate or extent of the chemical reactions and pathways resulting in the formation of melanin.
	GO:0040030	regulation of molecular function, epigenetic	Any heritable epigenetic process that modulates the frequency, rate or extent of protein function by self-perpetuating conformational conversions of normal proteins in healthy cells. This is distinct from, though mechanistically analogous to, disease states associated with prion propagation and amyloidogenesis. A single protein, if it carries a glutamine/asparagine-rich ('prion') domain, can sometimes stably exist in at least two distinct physical states, each associated with a different phenotype; propagation of one of these traits is achieved by a self-perpetuating change in the protein from one form to the other, mediated by conformational changes in the glutamine/asparagine-rich domain. Prion domains are both modular and transferable to other proteins, on which they can confer a heritable epigenetic alteration of function; existing bioinformatics data indicate that they are rare in non-eukarya, but common in eukarya.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005623	cell	The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2iqw)

	Sites
(no "Sites" information available for 2iqw)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2iqw)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2iqw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ASIP_HUMAN \| P42127
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	MC4R_HUMAN \| P32245
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	601665
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ASIP_HUMAN \| P42127
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	MC4R_HUMAN \| P32245
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ASIP_HUMAN \| P42127	:	1y7j 1y7k 2kza 2l1j
	MC4R_HUMAN \| P32245	:	2iqp 2iqr 2iqs 2iqu 2iqv

(no "Related Entries Specified in the PDB File" available for 2IQW)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (7, 7)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (28, 28)

PROSITE Motifs (3, 2)

Exons (2, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (44, 45)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File