|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 26)| Asymmetric/Biological Unit (3, 26) |
Sites (14, 14)
Asymmetric Unit (14, 14)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2IJL) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2IJL) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2IJL) |
Exons (0, 0)| (no "Exon" information available for 2IJL) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with A9CHN1_AGRFC | A9CHN1 from UniProtKB/TrEMBL Length:131 Alignment length:116 13 23 33 43 53 63 73 83 93 103 113 A9CHN1_AGRFC 4 KRLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFRQPVICSQRGGKQGGGAALTVFGAELLERYRGMEERMNEALREDIDWLEANRNPQ 119 SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2ijlA00 A:4-119 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 2ijl A 4 KRLPLKPVLRIDFPPGERLGHGKVELmQLIAETGSISAAGRAmDmSYRRAWLLVDALNHmFRQPVICSQR------GAALTVFGAELLERYRGmEERmNEALREDIDWLEANRNPQ 119 13 23 | 33 43 | | 53 63 73 | 83 93 | 103 113 30-MSE 46-MSE 63-MSE 73 80 97-MSE 48-MSE 101-MSE Chain B from PDB Type:PROTEIN Length:109 aligned with A9CHN1_AGRFC | A9CHN1 from UniProtKB/TrEMBL Length:131 Alignment length:115 14 24 34 44 54 64 74 84 94 104 114 A9CHN1_AGRFC 5 RLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFRQPVICSQRGGKQGGGAALTVFGAELLERYRGMEERMNEALREDIDWLEANRNPQ 119 SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2ijlB00 B:5-119 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 2ijl B 5 RLPLKPVLRIDFPPGERLGHGKVELmQLIAETGSISAAGRAmDmSYRRAWLLVDALNHmFRQPVICSQ------GGAALTVFGAELLERYRGmEERmNEALREDIDWLEANRNPQ 119 14 24 | 34 44 | | 54 64 | - | 84 94 | |104 114 30-MSE 46-MSE 63-MSE 72 79 97-MSE 48-MSE 101-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2IJL) |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2IJL) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (A9CHN1_AGRFC | A9CHN1)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|