Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PDZ DOMAIN OF EPSC FROM VIBRIO CHOLERAE, RESIDUES 219-305
 
Authors :  K. V. Korotkov, B. Krumm, M. Bagdasarian, W. G. J. Hol
Date :  29 Aug 06  (Deposition) - 17 Oct 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.63
Chains :  Asym./Biol. Unit :  A
Keywords :  Epsc, Gspc, Pdz Domain, Type 2 Secretion System, General Secretion Pathway, Protein Transport, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. V. Korotkov, B. Krumm, M. Bagdasarian, W. G. Hol
Structural And Functional Studies Of Epsc, A Crucial Component Of The Type 2 Secretion System From Vibrio Cholerae.
J. Mol. Biol. V. 363 311 2006
PubMed-ID: 16978643  |  Reference-DOI: 10.1016/J.JMB.2006.08.037
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GENERAL SECRETION PATHWAY PROTEIN C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidAVA0421
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentPDZ DOMAIN, RESIDUES 219-305
    GeneEPSC
    Organism ScientificVIBRIO CHOLERAE
    Organism Taxid666
    SynonymCHOLERA TOXIN SECRETION PROTEIN EPSC

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2I6V)

(-) Sites  (0, 0)

(no "Site" information available for 2I6V)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I6V)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I6V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I6V)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1T2SP_CPS01141 Bacterial type II secretion system protein C signature.GSPC_VIBCH243-269  1A:243-269

(-) Exons   (0, 0)

(no "Exon" information available for 2I6V)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:87
 aligned with GSPC_VIBCH | P45777 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:87
                                   228       238       248       258       268       278       288       298       
           GSPC_VIBCH   219 QEIFQYVRLSQVKRDDKVLGYRVSPGKDPVLFESIGLQDGDMAVALNGLDLTDPNVMNTLFQSMNEMTEMSLTVERDGQQHDVYIQF 305
               SCOP domains d2i6va1 A:219-305 General secretion pathway protein C, EpsC                             SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh.eeeeeeee..eeeeeeeee..hhhhhhhh......eeeee..ee..hhhhhhhhhhhhhhh.eeeeeeee..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------T2SP_C  PDB: A:243-269     ------------------------------------ PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                 2i6v A 219 QEIFQYVRLSQVKRDDKVLGYRVSPGKDPVLFESIGLQDGDMAVALNGLDLTDPNVMNTLFQSMNEMTEMSLTVERDGQQHDVYIQF 305
                                   228       238       248       258       268       278       288       298       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2I6V)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I6V)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (GSPC_VIBCH | P45777)
molecular function
    GO:0008565    protein transporter activity    Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
    GO:0009306    protein secretion    The controlled release of proteins from a cell.
    GO:0015628    protein secretion by the type II secretion system    The process in which proteins are secreted across the outer membrane of Gram-negative bacteria by the type II secretion system. Proteins using this pathway are first translocated across the cytoplasmic membrane via the Sec or Tat pathways.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0015627    type II protein secretion system complex    A large protein complex, containing 12-15 subunits, that spans the cell envelope of Gram-negative bacteria and mediates the movement of proteins into the extracellular environment. The complex includes a component in the cytoplasm, an inner membrane subcomplex that reaches into the periplasmic compartment and a secretion pore in the outer membrane. Proteins using the Type II pathway are transported across the cytoplasmic membrane by the Sec or Tat complex.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2i6v)
 
  Sites
(no "Sites" information available for 2i6v)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i6v)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i6v
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GSPC_VIBCH | P45777
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GSPC_VIBCH | P45777
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GSPC_VIBCH | P457772i4s

(-) Related Entries Specified in the PDB File

2i4s LONGER CONSTRUCT OF THE SAME PROTEIN.