Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PUTATIVE TETR TRANSCRIPTIONAL REGULATOR FROM RHODOCOCCUS SP. RHA1
 
Authors :  J. Osipiuk, E. Evdokimova, M. Kudritska, A. Savchenko, A. Edwards, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  11 Aug 06  (Deposition) - 12 Sep 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Apc5890, Tetr Family, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Osipiuk, E. Evdokimova, M. Kudritska, A. Savchenko, A. Edwards, A. Joachimiak
X-Ray Crystal Structure Of Putative Tetr Transcriptional Regulator From Rhodococcus Sp. Rha1.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE TETR TRANSCRIPTIONAL REGULATOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRHA1_RO09068
    Organism ScientificRHODOCOCCUS SP.
    Organism Taxid101510
    StrainRHA1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric/Biological Unit (3, 14)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
2NPO1Ligand/IonP-NITROPHENOL
3PGE1Ligand/IonTRIETHYLENE GLYCOL

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:175 , GLY A:176 , PRO A:178 , ARG B:129 , GLU B:130 , ARG B:160 , HOH B:257 , HOH B:280BINDING SITE FOR RESIDUE NPO B 201
2AC2SOFTWAREASP B:11 , LEU B:39 , LEU B:144 , ALA B:151 , GLY B:152 , THR B:153 , HOH B:260 , HOH B:292BINDING SITE FOR RESIDUE PGE B 202

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:66 -A:105
2B:66 -B:105

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I10)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I10)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I10)

(-) Exons   (0, 0)

(no "Exon" information available for 2I10)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:179
 aligned with Q0RX74_RHOJR | Q0RX74 from UniProtKB/TrEMBL  Length:198

    Alignment length:185
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189     
         Q0RX74_RHOJR    10 DDQVALQTAMELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYMCERTLQLEEAMVRPTAHEAVLDFLTGRVEVFTAPGQPFGCMTVQAGLASGEPHHEIVDLLTAAREQMRQTVLDRFEKALADGDLPAGTDCTALARYVMAAVYGLSVEAASGAPREELTAAAILAAQVVP 194
               SCOP domains d2i10a1 A:10-78 Putative transcriptional regulator RHA1_ro09068      d2i10a2 A:79-194 Pu      tative transcriptional regulator RHA1_ro09068                                               SCOP domains
               CATH domains 2i10A01 A:10-64,A:113-117 Homeodomain-like             -2i10A02 A:66-112,A:118-194                     2i10A2i10A02 A:66-112,A:118-194 Tetracycline Repressor, domain 2                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhhhhh------..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2i10 A  10 DDQVALQTAmELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYmCERTLQLEEAmVRPTAHEAVLDFLTGRVEVFT------GCmTVQAGLASGEPHHEIVDLLTAAREQmRQTVLDRFEKALADGDLPAGTDCTALARYVmAAVYGLSVEAASGAPREELTAAAILAAQVVP 194
                                    19        29        39        49        59     |  69      | 79        89       | -    | |109       119       129  |    139       149       159   |   169       179       189     
                                    19-MSE                                        65-MSE     76-MSE               97    104 |                       132-MSE                        163-MSE                           
                                                                                                                          106-MSE                                                                                    

Chain B from PDB  Type:PROTEIN  Length:182
 aligned with Q0RX74_RHOJR | Q0RX74 from UniProtKB/TrEMBL  Length:198

    Alignment length:186
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      
         Q0RX74_RHOJR    11 DQVALQTAMELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYMCERTLQLEEAMVRPTAHEAVLDFLTGRVEVFTAPGQPFGCMTVQAGLASGEPHHEIVDLLTAAREQMRQTVLDRFEKALADGDLPAGTDCTALARYVMAAVYGLSVEAASGAPREELTAAAILAAQVVPRA 196
               SCOP domains d2i10b1 B:11-78 Putative transcriptional regulator RHA1_ro09068     d2i10b2 B:79-196 Pu  tative transcri  ptional regulator RHA1_ro09068                                                   SCOP domains
               CATH domains 2i10B01 B:11-64,B:114-117 Homeodomain-like            -2i10B02 B:66-113,B:118-196                      2  i2i10B02 B:66-113,B:118-196 Tetracycline Repressor, domain 2                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhhhhh--.....hhhhhhh...--.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2i10 B  11 DQVALQTAmELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYmCERTLQLEEAmVRPTAHEAVLDFLTGRVEVFT--GQPFGCmTVQAGLAS--PHHEIVDLLTAAREQmRQTVLDRFEKALADGDLPAGTDCTALARYVmAAVYGLSVEAASGAPREELTAAAILAAQVVPRA 196
                                    20        30        40        50        60    |   70     |  80        90      |100     | 110   |  |120       130 |     140       150       160  |    170       180       190      
                                   19-MSE                                        65-MSE     76-MSE               97  |     |     114  |            132-MSE                        163-MSE                             
                                                                                                                   100     |        117                                                                               
                                                                                                                         106-MSE                                                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I10)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q0RX74_RHOJR | Q0RX74)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NPO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PGE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i10)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i10
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0RX74_RHOJR | Q0RX74
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q0RX74_RHOJR | Q0RX74
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2I10)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2I10)