|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 28)
|
(no "Site" information available for 2HZT) |
(no "SS Bond" information available for 2HZT) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2HZT) |
Asymmetric Unit (1, 4)
|
(no "Exon" information available for 2HZT) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:98 aligned with YTCD_BACSU | O34533 from UniProtKB/Swiss-Prot Length:126 Alignment length:104 10 20 30 40 50 60 70 80 90 100 YTCD_BACSU 1 MEKKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINR 104 SCOP domains ---------d2hzta1 A:4-98 Putative transcriptional regulator YtcD SCOP domains CATH domains -2 hztA00 A:2-98 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains Chain B from PDB Type:PROTEIN Length:98 aligned with YTCD_BACSU | O34533 from UniProtKB/Swiss-Prot Length:126 Alignment length:104 10 20 30 40 50 60 70 80 90 100 YTCD_BACSU 1 MEKKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINR 104 SCOP domains d2 hztb_ B: automated matches SCOP domains CATH domains -2 hztB00 B:2-98 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains Chain C from PDB Type:PROTEIN Length:95 aligned with YTCD_BACSU | O34533 from UniProtKB/Swiss-Prot Length:126 Alignment length:104 10 20 30 40 50 60 70 80 90 100 YTCD_BACSU 1 MEKKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINR 104 SCOP domains d2 hztc_ C: automated matches SCOP domains CATH domains -2 hztC00 C:2-98 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains Chain D from PDB Type:PROTEIN Length:95 aligned with YTCD_BACSU | O34533 from UniProtKB/Swiss-Prot Length:126 Alignment length:104 10 20 30 40 50 60 70 80 90 100 YTCD_BACSU 1 MEKKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINR 104 SCOP domains d2 hztd_ D: automated matches SCOP domains CATH domains -2 hztD00 D:2-98 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2HZT) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (YTCD_BACSU | O34533)
|
|
|
|
|
|
|