Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE TRANSCRIPTIONAL REGULATOR SCO7222, A TETR FROM STREPTOMYCES COELICOLOR
 
Authors :  A. U. Singer, T. Skarina, R. G. Zhang, O. Onopriyenko, A. M. Edwards, A. Joachimiak, A. Savchenko, Midwest Center For Structural Geno (Mcsg)
Date :  03 Aug 06  (Deposition) - 22 Aug 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Tetr Transcriptional Regulator, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. U. Singer, T. Skarina, R. G. Zhang, O. Onopriyenko, A. M. Edwards, A. Joachimiak, A. Savchenko
Structure Of The Transcriptional Regulator Sco7222, A Tetr From Streptomyces Coelicolor
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidP15TV-LIC
    Expression System StrainBL21-CODONPLUS(DE3)-RP, BL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneSCO7222
    Organism ScientificSTREPTOMYCES COELICOLOR
    Organism Taxid100226
    StrainA3(2)

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2HXO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2HXO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2HXO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2HXO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2HXO)

(-) Exons   (0, 0)

(no "Exon" information available for 2HXO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:207
 aligned with Q9K463_STRCO | Q9K463 from UniProtKB/TrEMBL  Length:236

    Alignment length:220
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234
         Q9K463_STRCO    15 LSRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHITGKAELLGAATDAVVTAAVTAGPTGAADSPQDAVRAVALGLWDATEAHPWLATQLATQLSRTPWGTVAPRIFESLGRQVQAMGVPEAHWFTASSALMHYILGAAGQNAANSASAGPVGADVDRDEFLDTVSTAWEGLDPDAYPFTRAVADQVRGHDDREQFLAGITLVLTGITALHRP 234
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hxoA01 A:15-77 Homeodomain-like                               2hxoA02 A:78-234 Tetracycline Repressor, domain 2                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh-------------hhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hxo A  15 LSRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHITGKAELLGAATDAVVTAAVTAGPTGAADSPQDAVRAVALGLWDATEAHPWLATQLATQLSRTPWGTVAPRIFESLGRQVQAmGVPEAHWFTASSALmHYILGAAGQNAAN-------------DEFLDTVSTAWEGLDPDAYPFTRAVADQVRGHDDREQFLAGITLVLTGITALHRP 234
                                    24        34        44        54        64        74        84        94       104       114       124       134   |   144       154       164 |       -     | 184       194       204       214       224       234
                                                                                                                                                     138-MSE        153-MSE      166           180                                                      

Chain B from PDB  Type:PROTEIN  Length:207
 aligned with Q9K463_STRCO | Q9K463 from UniProtKB/TrEMBL  Length:236

    Alignment length:220
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233
         Q9K463_STRCO    14 PLSRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHITGKAELLGAATDAVVTAAVTAGPTGAADSPQDAVRAVALGLWDATEAHPWLATQLATQLSRTPWGTVAPRIFESLGRQVQAMGVPEAHWFTASSALMHYILGAAGQNAANSASAGPVGADVDRDEFLDTVSTAWEGLDPDAYPFTRAVADQVRGHDDREQFLAGITLVLTGITALHR 233
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hxoB01 B:14-77 Homeodomain-like                                    2hxoB02 B:82-233 Tetracycline Repressor, domain 2                                                                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhh..hhhhhhhhhhhhhhhhhhhh----...hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh.---------hhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hxo B  14 PLSRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHITGKAELLGAATDAVVTAAVTA----AADSPQDAVRAVALGLWDATEAHPWLATQLATQLSRTPWGTVAPRIFESLGRQVQAmGVPEAHWFTASSALmHYILGAAGQNAANSA---------DRDEFLDTVSTAWEGLDPDAYPFTRAVADQVRGHDDREQFLAGITLVLTGITALHR 233
                                    23        33        43        53        63        73   |    83        93       103       113       123       133    |  143       153       163    |    -    |  183       193       203       213       223       233
                                                                                          77   82                                                     138-MSE        153-MSE        168       178                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2HXO)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HXO)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9K463_STRCO | Q9K463)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2hxo)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hxo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2hxo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9K463_STRCO | Q9K463
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9K463_STRCO | Q9K463
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2HXO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2HXO)