Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL GENOMICS, THE CRYSTAL STRUCTURE OF A PUTATIVE TRANSCRIPTIONAL REGULATOR FROM RHODOCOCCUS SP. RHA1
 
Authors :  K. Tan, E. Evdokimova, O. Kagan, A. Savchenko, A. Edwards, A. Joachimia Center For Structural Genomics (Mcsg)
Date :  05 Jul 06  (Deposition) - 08 Aug 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Apc6040, Transcriptional Regulator, Tetr Family, Rhodococcus Sp. Rha1, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transcription Regulator (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Tan, E. Evdokimova, O. Kagan, A. Savchenko, A. Edwards, A. Joachimiak
The Crystal Structure Of A Transcriptional Regulator From Rhodococcus Sp. Rha1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - A PUTATIVE TRANSCRIPTIONAL REGULATOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPET15B
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    Organism ScientificRHODOCOCCUS SP.
    Organism Taxid101510
    StrainRHA1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric/Biological Unit (3, 14)
No.NameCountTypeFull Name
1EDO7Ligand/Ion1,2-ETHANEDIOL
2MSE6Mod. Amino AcidSELENOMETHIONINE
3PG41Ligand/IonTETRAETHYLENE GLYCOL

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:146 , LEU B:74 , GLY B:77 , LYS B:78 , LEU B:97 , SER B:139 , GLY B:140 , LEU B:144 , PHE B:166BINDING SITE FOR RESIDUE PG4 B 214
2AC2SOFTWAREPHE A:184 , TYR A:186 , HIS B:137 , HOH B:330BINDING SITE FOR RESIDUE EDO A 301
3AC3SOFTWAREGLU A:81 , LEU A:97 , SER A:139 , GLY A:140 , ALA A:143 , LEU A:144 , TRP A:167BINDING SITE FOR RESIDUE EDO A 302
4AC4SOFTWAREARG A:156BINDING SITE FOR RESIDUE EDO A 303
5AC5SOFTWAREGLU A:189 , ALA A:193 , PHE A:196 , HOH A:361 , HOH A:367BINDING SITE FOR RESIDUE EDO A 304
6AC6SOFTWAREGLU A:88BINDING SITE FOR RESIDUE EDO A 305
7AC7SOFTWARESER A:114 , HOH A:381 , GLU B:36 , SER B:114 , MSE B:118BINDING SITE FOR RESIDUE EDO A 306
8AC8SOFTWAREPRO B:39 , ILE B:40 , LYS B:61 , HOH B:334BINDING SITE FOR RESIDUE EDO B 307

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2HKU)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Glu A:88 -Thr A:89

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2HKU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2HKU)

(-) Exons   (0, 0)

(no "Exon" information available for 2HKU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:191
 aligned with Q0SB15_RHOJR | Q0SB15 from UniProtKB/TrEMBL  Length:211

    Alignment length:191
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207 
         Q0SB15_RHOJR    18 QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT 208
               SCOP domains d2hkua1 A:18-87 Putative transcriptional regulator RHA1_ro03468       d2hkua2 A:88-208 Putative transcriptional regulator RHA1_ro03468                                                          SCOP domains
               CATH domains 2hkuA00 A:18-208 Tetracycline Repressor, domain 2                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.hhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hku A  18 QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAmLmTGRRSELRDLITDTLRTLHSSGEVALIRTLmRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT 208
                                    27        37        47        57        67        77        87        97       107       117|      127       137       147 |     157       167       177       187       197       207 
                                                                                                                            116-MSE                          149-MSE                                                       
                                                                                                                              118-MSE                                                                                      

Chain B from PDB  Type:PROTEIN  Length:185
 aligned with Q0SB15_RHOJR | Q0SB15 from UniProtKB/TrEMBL  Length:211

    Alignment length:192
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208  
         Q0SB15_RHOJR    19 TRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNTSI 210
               SCOP domains d2hkub1 B:19-87 Putative transcriptional regulator RHA1_ro03468      d2hkub2 B:88-210 Putative transcriptional regulator RHA1_ro03468                                                            SCOP domains
               CATH domains 2hkuB00 B:19-210 Tetracycline Repressor, domain 2                                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh...hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh.-------hhhhhhhhhhhhh..hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2hku B  19 TRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAmLmTGRRSELRDLITDTLRTLHSSGEVALIRTLmRTGWQLRAGIDVESKAFWSAIFGLVIQKTA-------SLEEAVAVIFANLQIPETVRNTSI 210
                                    28        38        48        58        68        78        88        98       108       118       128       138       148|      158       168       178|      188       198       208  
                                                                                                                           116-MSE                          149-MSE                       179     187                       
                                                                                                                             118-MSE                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HKU)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q0SB15_RHOJR | Q0SB15)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:88 - Thr A:89   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2hku
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0SB15_RHOJR | Q0SB15
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q0SB15_RHOJR | Q0SB15
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2HKU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2HKU)