Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)

(-) Description

Title :  CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS OF MARK1/PAR-1
 
Authors :  A. Marx, C. Nugoor, J. Mueller, S. Panneerselvam, E. -M. Mandelkow, E. Mandelkow
Date :  13 Jun 06  (Deposition) - 11 Jul 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Biol. Unit 9:  E,F  (1x)
Keywords :  Serine/Threonine Protein Kinase; Mark; Par-1; Kin1; Uba Domain, Signaling Protein, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Marx, C. Nugoor, J. Mueller, S. Panneerselvam, T. Timm, M. Bilang, E. Mylonas, D. I. Svergun, E. -M. Mandelkow, E. Mandelkow
Structural Variations In The Catalytic And Ubiquitin-Associated Domains Of Microtubule-Associated Protein/Microtubule Affinity Regulating Kinase (Mark) 1 And Mark2
J. Biol. Chem. V. 281 27586 2006
PubMed-ID: 16803889  |  Reference-DOI: 10.1074/JBC.M604865200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE MARK1
    ChainsA, B, C, D, E, F, G, H
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET16B
    Expression System StrainBL21AI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentCATALYTIC AND UBA DOMAINS, RESIDUES 38-364
    GeneMARK1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMAP/MICROTUBULE AFFINITY-REGULATING KINASE 1

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)A       
Biological Unit 2 (1x) B      
Biological Unit 3 (1x)  C     
Biological Unit 4 (1x)   D    
Biological Unit 5 (1x)    E   
Biological Unit 6 (1x)     F  
Biological Unit 7 (1x)      G 
Biological Unit 8 (1x)       H
Biological Unit 9 (1x)    EF  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2HAK)

(-) Sites  (0, 0)

(no "Site" information available for 2HAK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2HAK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2HAK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 13)

Asymmetric Unit (2, 13)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---A/C/D/E/FY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---A/B/C/D/E/F/G/HN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---AY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---AN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---BN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---CY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---CN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---DY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---DN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---EY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---EN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---FY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---FN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---GN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---HN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 9 (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_040760Y233CMARK1_HUMANUnclassified  ---E/FY226C
2UniProtVAR_040761N355TMARK1_HUMANUnclassified  ---E/FN348T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 24)

Asymmetric Unit (3, 24)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  8A:59-82
B:59-82
C:59-82
D:59-82
E:59-82
F:59-82
G:59-82
H:59-82
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  8A:171-183
B:171-183
C:171-183
D:171-183
E:171-183
F:171-183
G:171-183
H:171-183
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  8A:318-363
B:318-363
C:318-363
D:318-363
E:318-363
F:318-363
G:318-363
H:318-363
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1A:59-82
-
-
-
-
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1A:171-183
-
-
-
-
-
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1A:318-363
-
-
-
-
-
-
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
B:59-82
-
-
-
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
B:171-183
-
-
-
-
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
B:318-363
-
-
-
-
-
-
Biological Unit 3 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
-
C:59-82
-
-
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
-
C:171-183
-
-
-
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
-
C:318-363
-
-
-
-
-
Biological Unit 4 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
-
-
D:59-82
-
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
-
-
D:171-183
-
-
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
-
-
D:318-363
-
-
-
-
Biological Unit 5 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
-
-
-
E:59-82
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
-
-
-
E:171-183
-
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
-
-
-
E:318-363
-
-
-
Biological Unit 6 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
-
-
-
-
F:59-82
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
-
-
-
-
F:171-183
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
-
-
-
-
F:318-363
-
-
Biological Unit 7 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:59-82
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:171-183
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:318-363
-
Biological Unit 8 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:59-82
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:171-183
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:318-363
Biological Unit 9 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.MARK1_HUMAN66-89
 
 
 
 
 
 
 
  2-
-
-
-
E:59-82
F:59-82
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.MARK1_HUMAN178-190
 
 
 
 
 
 
 
  2-
-
-
-
E:171-183
F:171-183
-
-
3UBAPS50030 Ubiquitin-associated domain (UBA) profile.MARK1_HUMAN325-370
 
 
 
 
 
 
 
  2-
-
-
-
E:318-363
F:318-363
-
-

(-) Exons   (10, 80)

Asymmetric Unit (10, 80)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1cENST000003669171cENSE00001837704chr1:220701899-220702215317MARK1_HUMAN1-17170--
1.3bENST000003669173bENSE00001233400chr1:220752696-220752899204MARK1_HUMAN18-85688A:48-78
B:46-78
C:46-78
D:47-78
E:47-78
F:47-78
G:48-78
H:47-78
31
33
33
32
32
32
31
32
1.4aENST000003669174aENSE00001778982chr1:220754407-22075446054MARK1_HUMAN86-103188A:79-96
B:79-96
C:79-96
D:79-96
E:79-96
F:79-96
G:79-96
H:79-96
18
18
18
18
18
18
18
18
1.5ENST000003669175ENSE00001068911chr1:220771673-22077172149MARK1_HUMAN104-120178A:97-113
B:97-113
C:97-113
D:97-113
E:97-113
F:97-113
G:97-113
H:97-113
17
17
17
17
17
17
17
17
1.6ENST000003669176ENSE00001068914chr1:220773140-22077320566MARK1_HUMAN120-142238A:113-135
B:113-135
C:113-135
D:113-135
E:113-135
F:113-135
G:113-135
H:113-135
23
23
23
23
23
23
23
23
1.7ENST000003669177ENSE00001637875chr1:220777409-22077747971MARK1_HUMAN142-165248A:135-158
B:135-158
C:135-158
D:135-158
E:135-158
F:135-158
G:135-158
H:135-158
24
24
24
24
24
24
24
24
1.8ENST000003669178ENSE00001068918chr1:220789281-22078933757MARK1_HUMAN166-184198A:159-177
B:159-177
C:159-177
D:159-177
E:159-177
F:159-177
G:159-177
H:159-177
19
19
19
19
19
19
19
19
1.9ENST000003669179ENSE00001804157chr1:220791652-220791888237MARK1_HUMAN185-263798A:178-256 (gaps)
B:178-252 (gaps)
C:178-256 (gaps)
D:178-256 (gaps)
E:178-256
F:178-256
G:178-256 (gaps)
H:178-251 (gaps)
79
75
79
79
79
79
79
74
1.10ENST0000036691710ENSE00001068926chr1:220791978-220792097120MARK1_HUMAN264-303408A:257-296
B:258-296 (gaps)
C:257-296
D:257-296
E:257-296
F:257-296
G:257-296 (gaps)
H:268-296
40
39
40
40
40
40
40
29
1.11ENST0000036691711ENSE00001068924chr1:220804377-220804476100MARK1_HUMAN304-337348A:297-330
B:297-330 (gaps)
C:297-330
D:297-330
E:297-330
F:297-330
G:297-330
H:297-330
34
34
34
34
34
34
34
34
1.12ENST0000036691712ENSE00001068921chr1:220805543-220805655113MARK1_HUMAN337-374388A:330-364
B:330-364
C:330-364
D:330-364
E:330-364
F:330-364
G:330-364
H:330-364
35
35
35
35
35
35
35
35
1.13ENST0000036691713ENSE00001068912chr1:220808718-220808871154MARK1_HUMAN375-426520--
1.14ENST0000036691714ENSE00001068917chr1:220809175-220809368194MARK1_HUMAN426-490650--
1.15ENST0000036691715ENSE00001068916chr1:220823962-220824062101MARK1_HUMAN491-524340--
1.16ENST0000036691716ENSE00001068923chr1:220825328-220825492165MARK1_HUMAN524-579560--
1.17ENST0000036691717ENSE00001068915chr1:220826443-220826694252MARK1_HUMAN579-663850--
1.18ENST0000036691718ENSE00001068920chr1:220831132-22083117645MARK1_HUMAN663-678160--
1.19aENST0000036691719aENSE00001843396chr1:220835154-220835800647MARK1_HUMAN678-7951180--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:309
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:317
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       
          MARK1_HUMAN    55 PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hakA01 A:48-131 Phosphorylase Kinase; domain 1                                     2hakA02 A:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakA03 A:322-364                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..eeeeeeeee...eeeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee...........--------......hhhhhhh....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh..................hhhhhhhhhhhh.hhhhhhhhhhh...hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C-------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE -----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: A:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: A:48-78        Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: A:135-158Exon 1.8           Exon 1.9  PDB: A:178-256 (gaps) UniProt: 185-263                               Exon 1.10  PDB: A:257-296               Exon 1.11  PDB: A:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------Exon 1.6  PDB: A:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: A:330-364           Transcript 1 (2)
                 2hak A  48 PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTV--------GSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197    |    -   |   217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       
                                                                                                                                                                                    202      211                                                                                                                                                         

Chain B from PDB  Type:PROTEIN  Length:279
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:319
                                    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362         
          MARK1_HUMAN    53 EQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hakB01 B:46-131 Phosphorylase Kinase; domain 1                                       2hakB02 B:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakB03 B:322-364                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee..eeeeee.........eeeee.....eeeeeeee.........hhhhhhhhhhhhh.......eeeeee...eeeeee.......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh........hhh.eee.....eee..........-----------------------------.hhhhhhhhhhhhhhh......-----.hhhhhhh........hhhhhhhhhhhhh...--..hhhhhh........----.............hhhhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE -------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: B:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: B:46-78          Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: B:135-158Exon 1.8           Exon 1.9  PDB: B:178-252 (gaps) UniProt: 185-263 [INCOMPLETE]                  Exon 1.10  PDB: B:258-296 (gaps)        Exon 1.11  PDB: B:297-330 (gaps)  ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------Exon 1.6  PDB: B:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: B:330-364           Transcript 1 (2)
                 2hak B  46 EQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFT-----------------------------VDVWSLGVILYTLVSGSLPFDG-----LRERVLRGKYRIPFYMSTDCENLLKKLLVLNP--RGSLEQIMKDRWMNVG----ELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195     |   -         -         -     | 235       245      |  -  |    265       275       285   |  |295       305 |    |315       325       335       345       355         
                                                                                                                                                                                     201                           231                  252   258                            289  |            307  312                                                    
                                                                                                                                                                                                                                                                                292                                                                        

Chain C from PDB  Type:PROTEIN  Length:310
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:319
                                    62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362         
          MARK1_HUMAN    53 EQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hakC01 C:46-131 Phosphorylase Kinase; domain 1                                       2hakC02 C:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakC03 C:322-364                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee..eeeeeeeee...eeeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhh.........eeeeee...eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhh..---------....hhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh..................hhhhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C-------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE -------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: C:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: C:46-78          Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: C:135-158Exon 1.8           Exon 1.9  PDB: C:178-256 (gaps) UniProt: 185-263                               Exon 1.10  PDB: C:257-296               Exon 1.11  PDB: C:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------Exon 1.6  PDB: C:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: C:330-364           Transcript 1 (2)
                 2hak C  46 EQPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVG---------PPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       | -       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355         
                                                                                                                                                                                       203       213                                                                                                                                                       

Chain D from PDB  Type:PROTEIN  Length:309
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:318
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363        
          MARK1_HUMAN    54 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2hakD01 D:47-131 Phosphorylase Kinase; domain 1                                      2hakD02 D:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakD03 D:322-364                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..eeeeeeeee....eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhh.........eeeeee...eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..........eee.....eee.....hhhhh..---------....hhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhh.....hhhhh.hhhhhh.hhhhhh..................hhhhhhhhhhhh.hhhhhhhhhhh...hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C-------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE ------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: D:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: D:47-78         Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: D:135-158Exon 1.8           Exon 1.9  PDB: D:178-256 (gaps) UniProt: 185-263                               Exon 1.10  PDB: D:257-296               Exon 1.11  PDB: D:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.6  PDB: D:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: D:330-364           Transcript 1 (2)
                 2hak D  47 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVG---------PPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196      |  -      |216       226       236       246       256       266       276       286       296       306       316       326       336       346       356        
                                                                                                                                                                                      203       213                                                                                                                                                       

Chain E from PDB  Type:PROTEIN  Length:318
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:318
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363        
          MARK1_HUMAN    54 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2hakE01 E:47-131 Phosphorylase Kinase; domain 1                                      2hakE02 E:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakE03 E:322-364                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..eeeeeeeeee..eeeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeeeee..eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhh.....hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhh....hhhhh.hhhhhh.hhhhhh..................hhhhhhhhhhhh.hhhhhhhhhhh...hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C-------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE ------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: E:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: E:47-78         Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: E:135-158Exon 1.8           Exon 1.9  PDB: E:178-256 UniProt: 185-263                                      Exon 1.10  PDB: E:257-296               Exon 1.11  PDB: E:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.6  PDB: E:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: E:330-364           Transcript 1 (2)
                 2hak E  47 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356        

Chain F from PDB  Type:PROTEIN  Length:318
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:318
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363        
          MARK1_HUMAN    54 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2hakF01 F:47-131 Phosphorylase Kinase; domain 1                                      2hakF02 F:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakF03 F:322-364                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..eeeeeeeee....eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhh.........eeeeee...eeeeee.....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhh..hhhhhh.......hhhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhh.....hhhhh.hhhhhhhhhhhhh..................hhhhhhhhhhhh.hhhhhhhhhhh...hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------C-------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE ------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: F:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: F:47-78         Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: F:135-158Exon 1.8           Exon 1.9  PDB: F:178-256 UniProt: 185-263                                      Exon 1.10  PDB: F:257-296               Exon 1.11  PDB: F:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.6  PDB: F:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: F:330-364           Transcript 1 (2)
                 2hak F  47 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356        

Chain G from PDB  Type:PROTEIN  Length:297
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:317
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       
          MARK1_HUMAN    55 PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hakG01 G:48-131 Phosphorylase Kinase; domain 1                                     2hakG02 G:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2hakG03 G:322-364                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..eeeeeeeee...eeeeeeee.....eeeeeee.......hhhhhhhhhhhhhhhh.......eeeeee....eeeeee....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.....hhhhh.---------.......---------...hhhhhhhhhhhhhhhh.........hhhhhhhhhh........hhhhhhhh........--..hhhhhhhhhhhhh..................hhhhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE -----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: G:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: G:48-78        Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: G:135-158Exon 1.8           Exon 1.9  PDB: G:178-256 (gaps) UniProt: 185-263                               Exon 1.10  PDB: G:257-296 (gaps)        Exon 1.11  PDB: G:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------Exon 1.6  PDB: G:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: G:330-364           Transcript 1 (2)
                 2hak G  48 PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTV---------SPPYAAP---------GPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNP--RGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197    |    -    |  217|        -|      237       247       257       267       277       287 |  |  297       307       317       327       337       347       357       
                                                                                                                                                                                    202       212   218       228                                                          289  |                                                                        
                                                                                                                                                                                                                                                                              292                                                                        

Chain H from PDB  Type:PROTEIN  Length:277
 aligned with MARK1_HUMAN | Q9P0L2 from UniProtKB/Swiss-Prot  Length:795

    Alignment length:318
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363        
          MARK1_HUMAN    54 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 371
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2hakH01 H:47-135 Phosphorylase Kinase; domain 1                                          2hakH02 H:136-316 Transferase(Phosphotransferase) domain 1                                                                                                                           2hakH03 H:317-364                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..eeeeeeeee....eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee...........-------------------------hhhhhhhhhhhhhhhhhh......----------------......hhhhhhhhh.....hhhhh.hhhhhhhh.......................hhhhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T---------------- SAPs(SNPs)
                    PROSITE ------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: H:318-363 UniProt: 325-370          - PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: H:47-78         Exon 1.4a         Exon 1.5         ---------------------Exon 1.7  PDB: H:135-158Exon 1.8           Exon 1.9  PDB: H:178-251 (gaps) UniProt: 185-263 [INCOMPLETE]                  Exon 1.10  PDB: H:268-296 [INCOMPLETE]  Exon 1.11  PDB: H:297-330         ---------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.6  PDB: H:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: H:330-364           Transcript 1 (2)
                 2hak H  47 QPHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTV-------------------------GPEVDVWSLGVILYTLVSGSLPFD----------------RIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK 364
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196     |   -         -         - |     236       246    |    -         - |     276       286       296       306       316       326       336       346       356        
                                                                                                                                                                                     202                       228                    251              268                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2HAK)

(-) CATH Domains  (3, 24)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HAK)

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H   (MARK1_HUMAN | Q9P0L2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0070300    phosphatidic acid binding    Interacting selectively and non-covalently with phosphatidic acid, any of a class of glycerol phosphate in which both the remaining hydroxyl groups of the glycerol moiety are esterified with fatty acids.
    GO:0005546    phosphatidylinositol-4,5-bisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-4,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' and 5' positions.
    GO:0001786    phosphatidylserine binding    Interacting selectively and non-covalently with phosphatidylserine, a class of glycophospholipids in which a phosphatidyl group is esterified to the hydroxyl group of L-serine.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0050321    tau-protein kinase activity    Catalysis of the reaction: ATP + tau-protein = ADP + O-phospho-tau-protein.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0007010    cytoskeleton organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0001764    neuron migration    The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0015630    microtubule cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2hak)
 
  Sites
(no "Sites" information available for 2hak)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hak)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2hak
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MARK1_HUMAN | Q9P0L2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MARK1_HUMAN | Q9P0L2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MARK1_HUMAN | Q9P0L23ose

(-) Related Entries Specified in the PDB File

1y8g MARK2 CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS; T208A, S212A DOUBLE MUTANT; SELENOMETHIONINE DERIVATIVE
1zmu MARK2 CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS; WILD TYPE
1zmv MARK2 CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS; K82R MUTANT
1zmw MARK2 CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS; T208A, S212A DOUBLE MUTANT