Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  BUCAIN, A CARDIOTOXIN FROM THE MALAYAN KRAIT BUNGARUS CANDIDUS
 
Authors :  M. T. Murakami, R. M. Kini, R. K. Arni
Date :  08 Jun 06  (Deposition) - 19 Jun 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Bucain, Cardiotoxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. T. Murakami, R. M. Kini, R. K. Arni
Crystal Structure Of Bucain
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BUCAIN
    ChainsA, B
    Organism ScientificBUNGARUS CANDIDUS
    Organism Taxid92438

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2H8U)

(-) Sites  (0, 0)

(no "Site" information available for 2H8U)

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:3 -A:24
2A:17 -A:42
3A:46 -A:57
4A:58 -A:63
5B:3 -B:24
6B:17 -B:42
7B:46 -B:57
8B:58 -B:63

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Ser B:34 -Gly B:35

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2H8U)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3SO3_BUNCA41-61
 
  2A:41-61
B:41-61
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3SO3_BUNCA41-61
 
  1A:41-61
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3SO3_BUNCA41-61
 
  1-
B:41-61

(-) Exons   (0, 0)

(no "Exon" information available for 2H8U)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:65
 aligned with 3SO3_BUNCA | P83346 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:65
                                    10        20        30        40        50        60     
            3SO3_BUNCA    1 RKCLIKYSQANESSKTCPSGQLLCLKKWEIGNPSGKEVKRGCVATCPKPWKNEIIQCCAKDKCNA 65
               SCOP domains d2h8ua_ A: Bucain                                                 SCOP domains
               CATH domains 2h8uA00 A:1-65 CD59                                               CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee....eeeee......eeeeeee.........eeeee.........eeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------SNAKE_TOXIN          ---- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                  2h8u A  1 RKCLIKYSQANESSKTCPSGQLLCLKKWEIGNPSGKEVKRGCVATCPKPWKNEIIQCCAKDKCNA 65
                                    10        20        30        40        50        60     

Chain B from PDB  Type:PROTEIN  Length:65
 aligned with 3SO3_BUNCA | P83346 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:65
                                    10        20        30        40        50        60     
            3SO3_BUNCA    1 RKCLIKYSQANESSKTCPSGQLLCLKKWEIGNPSGKEVKRGCVATCPKPWKNEIIQCCAKDKCNA 65
               SCOP domains d2h8ub_ B: Bucain                                                 SCOP domains
               CATH domains 2h8uB00 B:1-65 CD59                                               CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee....eeeee......eeeeeee.........eeeee.........eeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------SNAKE_TOXIN          ---- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                  2h8u B  1 RKCLIKYSQANESSKTCPSGQLLCLKKWEIGNPSGKEVKRGCVATCPKPWKNEIIQCCAKDKCNA 65
                                    10        20        30        40        50        60     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2H8U)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (3SO3_BUNCA | P83346)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2h8u)
 
  Sites
(no "Sites" information available for 2h8u)
 
  Cis Peptide Bonds
    Ser B:34 - Gly B:35   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2h8u
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3SO3_BUNCA | P83346
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  3SO3_BUNCA | P83346
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        3SO3_BUNCA | P833461vyc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2H8U)