Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HTH-TYPE TRANSCRIPTIONAL REGULATOR PKSA RELATED PROTEIN FROM RHODOCOCCUS SP. RHA1
 
Authors :  B. Nocek, E. Evdokimova, O. Kagan, A. Savchenko, A. Edwards, A. Joachim Midwest Center For Structural Genomics (Mcsg)
Date :  22 Mar 06  (Deposition) - 25 Apr 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hth-Type Transcriptional Regulator, Transcriptional Regulator Tetr, Psi-2, Regulatory Protein, Structural Genomics, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. Nocek, E. Evdokimova, O. Kagan, A. Savchenko, A. Edwards, A. Joachimiak
Crystal Structure Of Hth-Type Transcriptional Regulator Pks Related Protein From Rhodococcus Sp. Rha1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HTH-TYPE TRANSCRIPTIONAL REGULATOR PKSA RELATED PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificRHODOCOCCUS SP.
    Organism Taxid101510
    StrainRHA1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG B:71 , ARG B:100 , HOH B:338BINDING SITE FOR RESIDUE CL B 210

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GFN)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr A:120 -Ala A:121

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GFN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GFN)

(-) Exons   (0, 0)

(no "Exon" information available for 2GFN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:192
 aligned with Q0S7R9_RHOJR | Q0S7R9 from UniProtKB/TrEMBL  Length:209

    Alignment length:196
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193      
         Q0S7R9_RHOJR     4 IVDHDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAMTRVFLFFYAEGAAEETARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVMKAISAEDAAARCVDAAVRR 199
               SCOP domains d2gfna1 A:4-80 Probable transcriptional regulator RHA1_ro04631               d2gfna2 A:81-199 Probable transcrip    tional regulator RHA1_ro04631                                                    SCOP domains
               CATH domains 2gfnA00 A:4-199 Tetracycline Repressor, domain 2                                                                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh----..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh..hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2gfn A   4 IVDHDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAmTRVFLFFYAEG----TARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVmKAISAEDAAARCVDAAVRR 199
                                    13        23        33        43        53        63        73        83        93       103|      113 |    |123       133       143       153       163       173      |183       193      
                                                                                                                              104-MSE    115  120                                                         180-MSE               

Chain B from PDB  Type:PROTEIN  Length:193
 aligned with Q0S7R9_RHOJR | Q0S7R9 from UniProtKB/TrEMBL  Length:209

    Alignment length:193
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196   
         Q0S7R9_RHOJR     7 HDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAMTRVFLFFYAEGAAEETARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVMKAISAEDAAARCVDAAVRR 199
               SCOP domains d2gfnb1 B:7-80 Probable transcriptional regulator RHA1_ro04631            d2gfnb2 B:81-199 Probable transcriptional regulator RHA1_ro04631                                                        SCOP domains
               CATH domains 2gfnB00 B:7-199 Tetracycline Repressor, domain 2                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2gfn B   7 HDERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRTILDEEGAGPIEKLRNITASILPLDERRLAmTRVFLFFYAEGAAEETARGEIAAFLARWRGVVRESVVAAQREGTVSTDLDADAVTVALVALTDGLALQAILDPVVmKAISAEDAAARCVDAAVRR 199
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176   |   186       196   
                                                                                                                           104-MSE                                                                     180-MSE               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GFN)

(-) Gene Ontology  (3, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q0S7R9_RHOJR | Q0S7R9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:120 - Ala A:121   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gfn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0S7R9_RHOJR | Q0S7R9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q5YVI4_NOCFA | Q5YVI4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q0S7R9_RHOJR | Q0S7R9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q5YVI4_NOCFA | Q5YVI4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2GFN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2GFN)