Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  PROTEIN MODELING OF ENOLASE (NEOCALLIMASTIX FRONTALIS)
 
Authors :  J. A. Brainerd, N. Vikash, A. Gopaal
Date :  17 Mar 06  (Deposition) - 04 Apr 06  (Release) - 04 Apr 06  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Enolase, Spdbv, Theoritical Protein Model (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. A. Brainerd, N. Vikash, A. Gopaal
Protein Modeling Of Enolase (Neocallimastix Frontalis)
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ENOLASE
    Chains: A
    EC Number: 4.2.1.11
    Organism Common: RUMEN FUNGUS
    Organism Scientific: NEOCALLIMASTIX FRONTALIS
    Synonym: 2-PHOSPHOGLYCERATE DEHYDRATASE, 2-PHOSPHO-D- GLYCERATE HYDRO-LYASE

 Structural Features

(-) Chains, Units

  
Theoretical Model : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2GE6)

(-) Sites  (0, 0)

(no "Site" information available for 2GE6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GE6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GE6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GE6)

(-) PROSITE Motifs  (1, 1)

Theoretical Model (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ENOLASEPS00164 Enolase signature.ENO_NEOFR344-357  1A:344-357

(-) Exons   (0, 0)

(no "Exon" information available for 2GE6)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:435
 aligned with ENO_NEOFR | P42894 from UniProtKB/Swiss-Prot  Length:436

    Alignment length:435
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431     
            ENO_NEOFR     2 AITKVHARQIFDSRGNPTVEVEVTTDKGLFRAAVPSGASTGVHEALELRDGIKADYVGKGVLKAVENVNKTIAPALVAANLDVKNQKAVDDFLLKLDGTPNKSKLGANAILGVSLAVARAGAADKGVPLYQHLGELAGNKGPWILPVPSMNVLNGGSHAGNKLAMQEFMILPTGAKSFTEALKMGSEVYHALKSVIKAKYGQDACNVGDEGGFAPNIQDNKEGLELLNEAIAKAGYTGKVKIGMDVASSEFYKDGKYDLDFKNPNSDPSKWISGEELGQFYKEITSEYPIVSIEDPYDQDDFESWSKFRADMQDKIQIVGDDLTVTNPKRIAMAIEKKACNGLLLKVNQIGTVSESIQAALDAFNDGWGVMVSHRSGETEDTFIADLVVGLKSGQIKTGAPCRSERLAKYNQLLRIEEELGANATYAGENFRRPF 436
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.....eeeeeeeee..eeeeee.....................hhhhh.hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.....eee.ee.eeeee.hhhh.......eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhh.....eeeee.hhhh.ee..ee.........hhhhh.hhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhh......eeee......hhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhhhhhh..eeeee........hhhhhhhhhh...eee.....hhhhhhhhhhhhhhhhhhh..eee.hhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ENOLASE       ------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ge6 A   2 AITKVHARQIFDSRGNPTVEVEVTTDKGLFRAAVPSGASTGVHEALELRDGIKADYVGKGVLKAVENVNKTIAPALVAANLDVKNQKAVDDFLLKLDGTPNKSKLGANAILGVSLAVARAGAADKGVPLYQHLGELAGNKGPWILPVPSMNVLNGGSHAGNKLAMQEFMILPTGAKSFTEALKMGSEVYHALKSVIKAKYGQDACNVGDEGGFAPNIQDNKEGLELLNEAIAKAGYTGKVKIGMDVASSEFYKDGKYDLDFKNPNSDPSKWISGEELGQFYKEITSEYPIVSIEDPYDQDDFESWSKFRADMQDKIQIVGDDLTVTNPKRIAMAIEKKACNGLLLKVNQIGTVSESIQAALDAFNDGWGVMVSHRSGETEDTFIADLVVGLKSGQIKTGAPCRSERLAKYNQLLRIEEELGANATYAGENFRRPF 436
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2GE6)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2GE6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GE6)

(-) Gene Ontology  (7, 7)

Theoretical Model(hide GO term definitions)
Chain A   (ENO_NEOFR | P42894)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004634    phosphopyruvate hydratase activity    Catalysis of the reaction: 2-phospho-D-glycerate = phosphoenolpyruvate + H2O.
biological process
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0000015    phosphopyruvate hydratase complex    A multimeric enzyme complex, usually a dimer or an octamer, that catalyzes the conversion of 2-phospho-D-glycerate to phosphoenolpyruvate and water.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ge6)
 
  Sites
(no "Sites" information available for 2ge6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ge6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ge6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ENO_NEOFR | P42894
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.11
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ENO_NEOFR | P42894
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2GE6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2GE6)