Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  PUTATIVE METHYLTRANSFERASE YHHF FROM ESCHERICHIA COLI.
 
Authors :  J. Osipiuk, Y. Kim, R. Sanishvili, T. Skarina, E. Evdokimova, A. Savche A. Edwards, A. Joachimiak, Midwest Center For Structural Genomi
Date :  16 Jan 06  (Deposition) - 28 Feb 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Keywords :  Structural Genomics, Putative Methyltransferase, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. V. Lesnyak, J. Osipiuk, T. Skarina, P. V. Sergiev, A. A. Bogdanov, A. Edwards, A. Savchenko, A. Joachimiak, O. A. Dontsova
Methyltransferase That Modifies Guanine 966 Of The 16 S Rrna: Functional Identification And Tertiary Structure.
J. Biol. Chem. V. 282 5880 2007
PubMed-ID: 17189261  |  Reference-DOI: 10.1074/JBC.M608214200

(-) Compounds

Molecule 1 - METHYLASE YHHF
    ChainsA, B, C, D, E, F
    EC Number2.1.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneYHHF
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    StrainK12

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A     
Biological Unit 2 (1x) B    
Biological Unit 3 (1x)  C   
Biological Unit 4 (1x)   D  
Biological Unit 5 (1x)    E 
Biological Unit 6 (1x)     F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 19)

Asymmetric Unit (3, 19)
No.NameCountTypeFull Name
1CL6Ligand/IonCHLORIDE ION
2EDO1Ligand/Ion1,2-ETHANEDIOL
3MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO-1Ligand/Ion1,2-ETHANEDIOL
3MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO1Ligand/Ion1,2-ETHANEDIOL
3MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO-1Ligand/Ion1,2-ETHANEDIOL
3MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO-1Ligand/Ion1,2-ETHANEDIOL
3MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 5 (1, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO-1Ligand/Ion1,2-ETHANEDIOL
3MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 6 (1, 2)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2EDO-1Ligand/Ion1,2-ETHANEDIOL
3MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:109 , ALA A:110 , MSE A:111 , LEU A:134 , ARG B:104BINDING SITE FOR RESIDUE CL A 401
2AC2SOFTWAREASN B:109 , ALA B:110 , MSE B:111 , LEU B:134 , ARG C:104BINDING SITE FOR RESIDUE CL B 402
3AC3SOFTWAREARG A:104 , ASN C:109 , ALA C:110 , MSE C:111 , LEU C:134BINDING SITE FOR RESIDUE CL C 403
4AC4SOFTWAREASN D:109 , ALA D:110 , MSE D:111 , LEU D:134 , ARG E:104BINDING SITE FOR RESIDUE CL D 404
5AC5SOFTWAREASN E:109 , ALA E:110 , MSE E:111 , LEU E:134 , ARG F:104BINDING SITE FOR RESIDUE CL E 405
6AC6SOFTWAREARG D:104 , ASN F:109 , ALA F:110 , MSE F:111 , LEU F:134BINDING SITE FOR RESIDUE CL F 406
7AC7SOFTWAREPRO B:49 , ASN B:122 , GLU B:151 , ALA B:152 , LEU B:153BINDING SITE FOR RESIDUE EDO B 407

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FPO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FPO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FPO)

(-) PROSITE Motifs  (1, 6)

Asymmetric Unit (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  6A:124-130
B:124-130
C:124-130
D:124-130
E:124-130
F:124-130
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  1A:124-130
-
-
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  1-
B:124-130
-
-
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  1-
-
C:124-130
-
-
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  1-
-
-
D:124-130
-
-
Biological Unit 5 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  1-
-
-
-
E:124-130
-
Biological Unit 6 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1N6_MTASEPS00092 N-6 Adenine-specific DNA methylases signature.RSMD_ECOLI124-130
 
 
 
 
 
  1-
-
-
-
-
F:124-130

(-) Exons   (0, 0)

(no "Exon" information available for 2FPO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:177
 aligned with RSMD_ECOLI | P0ADX9 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:183
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   
           RSMD_ECOLI    10 GQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
               SCOP domains d2fpoa1 A:10-192 Met      hylase YhhF                                                                                                                                                   SCOP domains
               CATH domains 2fpoA00 A:10-192 Vac      cinia Virus protein VP39                                                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..hhhhh..eee....------hhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh....eeee..hhhhhhh.....eeeeee.......hhhhhhhhhhhh..eeeeeeeeeeee.hhh.......eeeeeeeee..eeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------N6_MTAS-------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fpo A  10 GQIRIIGGQWRGRKLPVPDS------TDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEmDRAVSQQLIKNLATLKAGNARVVNSNAmSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
                                    19        29      | 39        49        59        69        79   |    89        99       109 |     119       129       139       149       159       169       179       189   
                                              29     36                                             83-MSE                     111-MSE                                                                             

Chain B from PDB  Type:PROTEIN  Length:178
 aligned with RSMD_ECOLI | P0ADX9 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:183
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   
           RSMD_ECOLI    10 GQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
               SCOP domains d2fpob_ B: Methylase      YhhF                                                                                                                                                          SCOP domains
               CATH domains 2fpoB00 B:10-192 Vacc     inia Virus protein VP39                                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..hhhhh..eee.....-----hhhhhhhhhhhhh......eeee.....hhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh...eeee..hhhhhhh.....eeeeee.......hhhhhhhhhhhh..eeeeeeeeeeee...........eeeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------N6_MTAS-------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fpo B  10 GQIRIIGGQWRGRKLPVPDSP-----TDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEmDRAVSQQLIKNLATLKAGNARVVNSNAmSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
                                    19        29|     | 39        49        59        69        79   |    89        99       109 |     119       129       139       149       159       169       179       189   
                                               30    36                                             83-MSE                     111-MSE                                                                             

Chain C from PDB  Type:PROTEIN  Length:181
 aligned with RSMD_ECOLI | P0ADX9 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:183
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   
           RSMD_ECOLI    10 GQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
               SCOP domains d2fpoc_ C: Methylas  e YhhF                                                                                                                                                             SCOP domains
               CATH domains 2fpoC00 C:10-192 Va  ccinia Virus protein VP39                                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.........eee...--.....hhhhhhhhhhhhh......eeee.....hhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhh...eeeee.hhhhhhh.....eeeeee.......hhhhhhhhhhhh..eeeeeeeeeeee...........eeeeeeeee..eeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------N6_MTAS-------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fpo C  10 GQIRIIGGQWRGRKLPVPD--GLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEmDRAVSQQLIKNLATLKAGNARVVNSNAmSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
                                    19        |- |      39        49        59        69        79   |    89        99       109 |     119       129       139       149       159       169       179       189   
                                             28 31                                                  83-MSE                     111-MSE                                                                             

Chain D from PDB  Type:PROTEIN  Length:179
 aligned with RSMD_ECOLI | P0ADX9 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:183
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   
           RSMD_ECOLI    10 GQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
               SCOP domains d2fpod_ D: Methylase Y    hhF                                                                                                                                                           SCOP domains
               CATH domains 2fpoD00 D:10-192 Vacci    nia Virus protein VP39                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..hhhhh..eee......----hhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh....eeeee.hhhhhhh.....eeeeee.......hhhhhhhhhhhh..eeeeeeeeeeee.hhh.......eeeeeeeee..eeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------N6_MTAS-------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fpo D  10 GQIRIIGGQWRGRKLPVPDSPG----TDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEmDRAVSQQLIKNLATLKAGNARVVNSNAmSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
                                    19        29 |    | 39        49        59        69        79   |    89        99       109 |     119       129       139       149       159       169       179       189   
                                                31   36                                             83-MSE                     111-MSE                                                                             

Chain E from PDB  Type:PROTEIN  Length:178
 aligned with RSMD_ECOLI | P0ADX9 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:183
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   
           RSMD_ECOLI    10 GQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
               SCOP domains d2fpoe_ E: Methylase      YhhF                                                                                                                                                          SCOP domains
               CATH domains 2fpoE00 E:10-192 Vacc     inia Virus protein VP39                                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.........eee.....-----hhhhhhhhhhhhh......eeee.....hhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhh...eeeee.hhhhhhh.....eeeeee.......hhhhhhhhhhhh..eeeeeeeeeeee...........eeeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------N6_MTAS-------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fpo E  10 GQIRIIGGQWRGRKLPVPDSP-----TDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEmDRAVSQQLIKNLATLKAGNARVVNSNAmSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
                                    19        29|     | 39        49        59        69        79   |    89        99       109 |     119       129       139       149       159       169       179       189   
                                               30    36                                             83-MSE                     111-MSE                                                                             

Chain F from PDB  Type:PROTEIN  Length:177
 aligned with RSMD_ECOLI | P0ADX9 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:183
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189   
           RSMD_ECOLI    10 GQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAGQVAYRLYQREAQ 192
               SCOP domains d2fpof_ F: Methyla   se YhhF                                                                                                                                                            SCOP domains
               CATH domains 2fpoF00 F:10-192 V   accinia Virus protein VP39                                                                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..hhhhh..eee..---......hhhhhhhhhhh.......eeee.....hhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh....eeee..hhhhhhh.....eeeeee.......hhhhhhhhhhhh..eeeeeeeeeeee..---......eeeeeeeee..eeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------N6_MTAS-------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fpo F  10 GQIRIIGGQWRGRKLPVP---GLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEmDRAVSQQLIKNLATLKAGNARVVNSNAmSFLAQKGTPHNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVE---PTVPANWSLHREKVAGQVAYRLYQREAQ 192
                                    19       | - |      39        49        59        69        79   |    89        99       109 |     119       129       139       149       159 |   | 169       179       189   
                                            27  31                                                  83-MSE                     111-MSE                                           161 165                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit

(-) CATH Domains  (1, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FPO)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (RSMD_ECOLI | P0ADX9)
molecular function
    GO:0052913    16S rRNA (guanine(966)-N(2))-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + guanosine(966) in 16S rRNA = N(2)-methylguanosine(966) in 16S rRNA + S-adenosyl-L-homocysteine.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0070475    rRNA base methylation    The addition of a methyl group to an atom in the nucleoside base portion of a nucleotide residue in an rRNA molecule.
    GO:0031167    rRNA methylation    The posttranscriptional addition of methyl groups to specific residues in an rRNA molecule.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fpo)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fpo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RSMD_ECOLI | P0ADX9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RSMD_ECOLI | P0ADX9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FPO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FPO)