Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BACTERIOPHAGE 186
 
Authors :  M. Lewis
Date :  03 Jan 06  (Deposition) - 13 Jun 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Biol. Unit 3:  A,B  (2x)
Keywords :  Genetic Switch, Regulation, Repressor, Cooperativity, Transcription Regulator (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Pinkett, K. E. Shearwin, S. Stayrook, I. B. Dodd, T. Burr, A. Hochschild, J. B. Egan, M. Lewis
The Structural Basis Of Cooperative Regulation At An Alternate Genetic Switch
Mol. Cell V. 21 605 2006
PubMed-ID: 16507359  |  Reference-DOI: 10.1016/J.MOLCEL.2006.01.019
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - REPRESSOR PROTEIN CI
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneCI
    MutationYES
    Organism ScientificENTEROBACTERIA PHAGE 186
    Organism Taxid29252

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (2x)AB
Biological Unit 3 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2FJR)

(-) Sites  (0, 0)

(no "Site" information available for 2FJR)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FJR)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FJR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FJR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FJR)

(-) Exons   (0, 0)

(no "Exon" information available for 2FJR)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:189
 aligned with RPC1_BP186 | P08707 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:189
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183         
           RPC1_BP186     4 DSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIEGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN 192
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhh...............eeeeeeee..eeeeeeeee.hhhhh......eeeeee..eeeeee.......eeeeeee..eeeeeeeeee...eeeee.....eeee....eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fjr A   4 DSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIKGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN 192
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183         

Chain B from PDB  Type:PROTEIN  Length:189
 aligned with RPC1_BP186 | P08707 from UniProtKB/Swiss-Prot  Length:192

    Alignment length:189
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183         
           RPC1_BP186     4 DSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIEGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN 192
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhh...hhhhhh....hhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhh................eeeeeeee..eeeeeeeee.hhhhh......eeeeee..eeeeee.......eeeeeee..eeeeeeeeee...eeeee.....eeee....eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fjr B   4 DSLGWSNVDVLDRICEAYGFSQKIQLANHFDIASSSLSNRYTRGAISYDFAAHCALETGANLQWLLTGEGEAFVNNRESSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIKGAISIRELTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN 192
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2FJR)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2FJR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FJR)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RPC1_BP186 | P08707)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0051259    protein oligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2fjr)
 
  Sites
(no "Sites" information available for 2fjr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fjr)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fjr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RPC1_BP186 | P08707
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RPC1_BP186 | P08707
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RPC1_BP186 | P087072fkd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FJR)