|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)
Asymmetric Unit (3, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2FBH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2FBH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FBH) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2FBH) |
Exons (0, 0)| (no "Exon" information available for 2FBH) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:137 aligned with Q9HYQ4_PSEAE | Q9HYQ4 from UniProtKB/TrEMBL Length:144 Alignment length:137 17 27 37 47 57 67 77 87 97 107 117 127 137 Q9HYQ4_PSEAE 8 YFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILANLENR 144 SCOP domains d2fbha1 A:8-144 Transcriptional regulator PA3341 SCOP domains CATH domains 2fbhA00 A:8-144 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 2fbh A 8 YFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILANLENR 144 17 27 37 47 57 67 77 87 97 107 117 127 137
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FBH) |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9HYQ4_PSEAE | Q9HYQ4)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|