Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE B-RAF KINASE DOMAIN BOUND TO SB-590885
 
Authors :  J. C. Lougheed, J. Lee, D. C. Chau, T. J. Stout
Date :  08 Dec 05  (Deposition) - 12 Dec 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Kinase Domain, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. J. King, D. R. Patrick, R. S. Batorsky, M. L. Ho, H. T. Do, S. Y. Zhang, R. Kumar, D. W. Rusnak, A. K. Takle, D. M. Wilson, E. Hugger, L. Wang, F. Karreth, J. C. Lougheed, J. Lee, D. Chau, T. J. Stout, E. W. May, C. M. Rominger, M. D. Schaber, L. Luo, A. S. Lakdawala, J. L. Adams, R. G. Contractor, K. S. Smalley, M. Herlyn, M. M. Morrissey, D. A. Tuveson, P. S. Huang
Demonstration Of A Genetic Therapeutic Index For Tumors Expressing Oncogenic Braf By The Kinase Inhibitor Sb-590885.
Cancer Res. V. 66 11100 2006
PubMed-ID: 17145850  |  Reference-DOI: 10.1158/0008-5472.CAN-06-2554
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    ChainsA, B
    EC Number2.7.1.37
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF-9
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidPACGP67
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentB-RAF KINASE DOMAIN, RESIDUES 445-723
    GeneBRAF, BRAF1, RAFB1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymP94, V-RAF MURINE SARCOMA VIRAL ONCOGENE HOMOLOG B1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
12152Ligand/Ion(1Z)-5-(2-{4-[2-(DIMETHYLAMINO)ETHOXY]PHENYL}-5-PYRIDIN-4-YL-1H-IMIDAZOL-4-YL)INDAN-1-ONE OXIME
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
12151Ligand/Ion(1Z)-5-(2-{4-[2-(DIMETHYLAMINO)ETHOXY]PHENYL}-5-PYRIDIN-4-YL-1H-IMIDAZOL-4-YL)INDAN-1-ONE OXIME
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
12151Ligand/Ion(1Z)-5-(2-{4-[2-(DIMETHYLAMINO)ETHOXY]PHENYL}-5-PYRIDIN-4-YL-1H-IMIDAZOL-4-YL)INDAN-1-ONE OXIME

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:673 , ALA B:481 , LYS B:483 , GLU B:501 , THR B:529 , TRP B:531 , CYS B:532 , TYR B:538 , ILE B:543 , PHE B:583 , ASP B:594 , ASN B:661BINDING SITE FOR RESIDUE 215 B 101
2AC2SOFTWAREILE A:463 , GLY A:464 , VAL A:471 , ALA A:481 , LYS A:483 , GLU A:501 , THR A:529 , CYS A:532 , PHE A:583 , ASP A:594BINDING SITE FOR RESIDUE 215 A 102

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FB8)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Lys A:522 -Pro A:523
2Lys B:522 -Pro B:523

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (35, 70)

Asymmetric Unit (35, 70)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_018613R462IBRAF_HUMANDisease (CRC)180177032A/BR462I
02UniProtVAR_018614I463SBRAF_HUMANDisease (CRC)180177033A/BI463S
03UniProtVAR_018615G464EBRAF_HUMANDisease (CRC)121913348A/BG464E
04UniProtVAR_018616G464VBRAF_HUMANUnclassified121913348A/BG464V
05UniProtVAR_018617G466ABRAF_HUMANUnclassified121913351A/BG466A
06UniProtVAR_018618G466EBRAF_HUMANUnclassified121913351A/BG466E
07UniProtVAR_018512G466VBRAF_HUMANDisease (LNCR)121913351A/BG466V
08UniProtVAR_035096S467ABRAF_HUMANDisease (CFC1)869025606A/BS467A
09UniProtVAR_035097F468SBRAF_HUMANDisease (CFC1)397507473A/BF468S
10UniProtVAR_018620G469ABRAF_HUMANDisease (NHL)121913355A/BG469A
11UniProtVAR_018621G469EBRAF_HUMANUnclassified121913355A/BG469E
12UniProtVAR_018622G469RBRAF_HUMANDisease (NHL)121913357A/BG469R
13UniProtVAR_040392G469VBRAF_HUMANUnclassified121913355A/BG469V
14UniProtVAR_026115L485FBRAF_HUMANDisease (CFC1)180177036A/BL485F
15UniProtVAR_026116K499EBRAF_HUMANDisease (CFC1)180177037A/BK499E
16UniProtVAR_058625K499NBRAF_HUMANDisease (CFC1)397507476A/BK499N
17UniProtVAR_026117E501GBRAF_HUMANDisease (CFC1)180177039A/BE501G
18UniProtVAR_026118E501KBRAF_HUMANDisease (CFC1)180177038A/BE501K
19UniProtVAR_058626L525PBRAF_HUMANDisease (CFC1)869025340A/BL525P
20UniProtVAR_058627W531CBRAF_HUMANDisease (NS7)606231228A/BW531C
21UniProtVAR_065173N580DBRAF_HUMANDisease (CFC1)  ---A/BN580D
22UniProtVAR_026119N581DBRAF_HUMANDisease (CFC1)180177040A/BN581D
23UniProtVAR_040393N581SBRAF_HUMANUnclassified121913370A/BN581S
24UniProtVAR_018623E586KBRAF_HUMANUnclassified121913340A/BE586K
25UniProtVAR_018624D594GBRAF_HUMANDisease (NHL)121913338A/BD594G
26UniProtVAR_018625F595LBRAF_HUMANUnclassified121913341A/BF595L
27UniProtVAR_018626G596RBRAF_HUMANUnclassified121913361A/BG596R
28UniProtVAR_035098G596VBRAF_HUMANDisease (CFC1)397507483A/BG596V
29UniProtVAR_018513L597RBRAF_HUMANDisease (LNCR)121913366A/BL597R
30UniProtVAR_018627L597VBRAF_HUMANDisease (NS7)121913369A/BL597V
31UniProtVAR_058628T599RBRAF_HUMANDisease (CFC1)  ---A/BT599R
32UniProtVAR_018628V600DBRAF_HUMANUnclassified121913377A/BV600D
33UniProtVAR_018629V600EBRAF_HUMANDisease (CRC)113488022A/BV600E
34UniProtVAR_058630D638EBRAF_HUMANDisease (CFC1)180177042A/BD638E
35UniProtVAR_058631Q709RBRAF_HUMANDisease (CFC1)397507486A/BQ709R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (35, 35)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_018613R462IBRAF_HUMANDisease (CRC)180177032AR462I
02UniProtVAR_018614I463SBRAF_HUMANDisease (CRC)180177033AI463S
03UniProtVAR_018615G464EBRAF_HUMANDisease (CRC)121913348AG464E
04UniProtVAR_018616G464VBRAF_HUMANUnclassified121913348AG464V
05UniProtVAR_018617G466ABRAF_HUMANUnclassified121913351AG466A
06UniProtVAR_018618G466EBRAF_HUMANUnclassified121913351AG466E
07UniProtVAR_018512G466VBRAF_HUMANDisease (LNCR)121913351AG466V
08UniProtVAR_035096S467ABRAF_HUMANDisease (CFC1)869025606AS467A
09UniProtVAR_035097F468SBRAF_HUMANDisease (CFC1)397507473AF468S
10UniProtVAR_018620G469ABRAF_HUMANDisease (NHL)121913355AG469A
11UniProtVAR_018621G469EBRAF_HUMANUnclassified121913355AG469E
12UniProtVAR_018622G469RBRAF_HUMANDisease (NHL)121913357AG469R
13UniProtVAR_040392G469VBRAF_HUMANUnclassified121913355AG469V
14UniProtVAR_026115L485FBRAF_HUMANDisease (CFC1)180177036AL485F
15UniProtVAR_026116K499EBRAF_HUMANDisease (CFC1)180177037AK499E
16UniProtVAR_058625K499NBRAF_HUMANDisease (CFC1)397507476AK499N
17UniProtVAR_026117E501GBRAF_HUMANDisease (CFC1)180177039AE501G
18UniProtVAR_026118E501KBRAF_HUMANDisease (CFC1)180177038AE501K
19UniProtVAR_058626L525PBRAF_HUMANDisease (CFC1)869025340AL525P
20UniProtVAR_058627W531CBRAF_HUMANDisease (NS7)606231228AW531C
21UniProtVAR_065173N580DBRAF_HUMANDisease (CFC1)  ---AN580D
22UniProtVAR_026119N581DBRAF_HUMANDisease (CFC1)180177040AN581D
23UniProtVAR_040393N581SBRAF_HUMANUnclassified121913370AN581S
24UniProtVAR_018623E586KBRAF_HUMANUnclassified121913340AE586K
25UniProtVAR_018624D594GBRAF_HUMANDisease (NHL)121913338AD594G
26UniProtVAR_018625F595LBRAF_HUMANUnclassified121913341AF595L
27UniProtVAR_018626G596RBRAF_HUMANUnclassified121913361AG596R
28UniProtVAR_035098G596VBRAF_HUMANDisease (CFC1)397507483AG596V
29UniProtVAR_018513L597RBRAF_HUMANDisease (LNCR)121913366AL597R
30UniProtVAR_018627L597VBRAF_HUMANDisease (NS7)121913369AL597V
31UniProtVAR_058628T599RBRAF_HUMANDisease (CFC1)  ---AT599R
32UniProtVAR_018628V600DBRAF_HUMANUnclassified121913377AV600D
33UniProtVAR_018629V600EBRAF_HUMANDisease (CRC)113488022AV600E
34UniProtVAR_058630D638EBRAF_HUMANDisease (CFC1)180177042AD638E
35UniProtVAR_058631Q709RBRAF_HUMANDisease (CFC1)397507486AQ709R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (35, 35)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_018613R462IBRAF_HUMANDisease (CRC)180177032BR462I
02UniProtVAR_018614I463SBRAF_HUMANDisease (CRC)180177033BI463S
03UniProtVAR_018615G464EBRAF_HUMANDisease (CRC)121913348BG464E
04UniProtVAR_018616G464VBRAF_HUMANUnclassified121913348BG464V
05UniProtVAR_018617G466ABRAF_HUMANUnclassified121913351BG466A
06UniProtVAR_018618G466EBRAF_HUMANUnclassified121913351BG466E
07UniProtVAR_018512G466VBRAF_HUMANDisease (LNCR)121913351BG466V
08UniProtVAR_035096S467ABRAF_HUMANDisease (CFC1)869025606BS467A
09UniProtVAR_035097F468SBRAF_HUMANDisease (CFC1)397507473BF468S
10UniProtVAR_018620G469ABRAF_HUMANDisease (NHL)121913355BG469A
11UniProtVAR_018621G469EBRAF_HUMANUnclassified121913355BG469E
12UniProtVAR_018622G469RBRAF_HUMANDisease (NHL)121913357BG469R
13UniProtVAR_040392G469VBRAF_HUMANUnclassified121913355BG469V
14UniProtVAR_026115L485FBRAF_HUMANDisease (CFC1)180177036BL485F
15UniProtVAR_026116K499EBRAF_HUMANDisease (CFC1)180177037BK499E
16UniProtVAR_058625K499NBRAF_HUMANDisease (CFC1)397507476BK499N
17UniProtVAR_026117E501GBRAF_HUMANDisease (CFC1)180177039BE501G
18UniProtVAR_026118E501KBRAF_HUMANDisease (CFC1)180177038BE501K
19UniProtVAR_058626L525PBRAF_HUMANDisease (CFC1)869025340BL525P
20UniProtVAR_058627W531CBRAF_HUMANDisease (NS7)606231228BW531C
21UniProtVAR_065173N580DBRAF_HUMANDisease (CFC1)  ---BN580D
22UniProtVAR_026119N581DBRAF_HUMANDisease (CFC1)180177040BN581D
23UniProtVAR_040393N581SBRAF_HUMANUnclassified121913370BN581S
24UniProtVAR_018623E586KBRAF_HUMANUnclassified121913340BE586K
25UniProtVAR_018624D594GBRAF_HUMANDisease (NHL)121913338BD594G
26UniProtVAR_018625F595LBRAF_HUMANUnclassified121913341BF595L
27UniProtVAR_018626G596RBRAF_HUMANUnclassified121913361BG596R
28UniProtVAR_035098G596VBRAF_HUMANDisease (CFC1)397507483BG596V
29UniProtVAR_018513L597RBRAF_HUMANDisease (LNCR)121913366BL597R
30UniProtVAR_018627L597VBRAF_HUMANDisease (NS7)121913369BL597V
31UniProtVAR_058628T599RBRAF_HUMANDisease (CFC1)  ---BT599R
32UniProtVAR_018628V600DBRAF_HUMANUnclassified121913377BV600D
33UniProtVAR_018629V600EBRAF_HUMANDisease (CRC)113488022BV600E
34UniProtVAR_058630D638EBRAF_HUMANDisease (CFC1)180177042BD638E
35UniProtVAR_058631Q709RBRAF_HUMANDisease (CFC1)397507486BQ709R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BRAF_HUMAN463-483
 
  2A:463-483
B:463-483
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.BRAF_HUMAN572-584
 
  2A:572-584
B:572-584
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BRAF_HUMAN463-483
 
  1A:463-483
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.BRAF_HUMAN572-584
 
  1A:572-584
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BRAF_HUMAN463-483
 
  1-
B:463-483
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.BRAF_HUMAN572-584
 
  1-
B:572-584

(-) Exons   (8, 16)

Asymmetric Unit (8, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002886021aENSE00001154485chr7:140624564-140624366199BRAF_HUMAN1-46460--
1.2ENST000002886022ENSE00001035281chr7:140550012-140549911102BRAF_HUMAN47-80340--
1.3aENST000002886023aENSE00001035295chr7:140534672-140534409264BRAF_HUMAN81-168880--
1.4ENST000002886024ENSE00001034889chr7:140508795-140508692104BRAF_HUMAN169-203350--
1.6ENST000002886026ENSE00001034814chr7:140507862-140507760103BRAF_HUMAN203-237350--
1.7ENST000002886027ENSE00001034880chr7:140501360-140501212149BRAF_HUMAN238-287500--
1.8ENST000002886028ENSE00001034818chr7:140500281-140500162120BRAF_HUMAN287-327410--
1.9ENST000002886029ENSE00001034830chr7:140494267-140494108160BRAF_HUMAN327-380540--
1.10ENST0000028860210ENSE00001034865chr7:140487384-14048734837BRAF_HUMAN381-393130--
1.11ENST0000028860211ENSE00001034844chr7:140482957-140482821137BRAF_HUMAN393-438460--
1.12ENST0000028860212ENSE00001034859chr7:140481493-140481376118BRAF_HUMAN439-478402A:449-478
B:449-478
30
30
1.13ENST0000028860213ENSE00001034883chr7:140477875-14047779185BRAF_HUMAN478-506292A:478-506
B:478-506
29
29
1.14ENST0000028860214ENSE00001034826chr7:140476888-140476712177BRAF_HUMAN506-565602A:506-565
B:506-565
60
60
1.15aENST0000028860215aENSE00001034811chr7:140454033-14045398747BRAF_HUMAN565-581172A:565-581
B:565-581
17
17
1.16ENST0000028860216ENSE00001034798chr7:140453193-140453075119BRAF_HUMAN581-620402A:581-620 (gaps)
B:581-620 (gaps)
40
40
1.17ENST0000028860217ENSE00001034817chr7:140449218-140449087132BRAF_HUMAN621-664442A:621-664
B:621-664
44
44
1.19ENST0000028860219ENSE00001034824chr7:140439746-140439612135BRAF_HUMAN665-709452A:665-709
B:665-709
45
45
1.20dENST0000028860220dENSE00001034876chr7:140434570-140434279292BRAF_HUMAN710-766572A:710-720
B:710-720
11
11

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:259
 aligned with BRAF_HUMAN | P15056 from UniProtKB/Swiss-Prot  Length:766

    Alignment length:272
                                   458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718  
           BRAF_HUMAN   449 DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS 720
               SCOP domains d2fb8a_ A: automated matches                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2fb8A01 A:449-533 Phosphorylase Kinase; domain 1                                     2fb8A02 A:534-720 Transferase(Phosphotransferase) domain 1                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeee....eeeeee...eeeeee......hhhhhhhhhhhhhhhh.........eeeee.....eeeee...eeehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...........eeee...eeee........-------------..hhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..........hhhhhhhhhhh.....hhhhh....hhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -------------ISE-AASA---------------F-------------E-G-----------------------P-----C------------------------------------------------DD----K-------GLRR-RD-------------------------------------E----------------------------------------------------------------------R----------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------V-E--E-----------------------------N-K-------------------------------------------------------------------------------S--------------VV--E------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------V--R----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE --------------PROTEIN_KINASE_ATP   ----------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: A:449-478     ---------------------------Exon 1.14  PDB: A:506-565 UniProt: 506-565                  ---------------Exon 1.16  PDB: A:581-620 (gaps)        Exon 1.17  PDB: A:621-664 UniProt: 621-664  Exon 1.19  PDB: A:665-709 UniProt: 665-709   Exon 1.20d  Transcript 1 (1)
           Transcript 1 (2) -----------------------------Exon 1.13  PDB: A:478-506    ----------------------------------------------------------Exon 1.15a       ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2fb8 A 449 DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV-------------SGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS 720
                                   458       468       478       488       498       508       518       528       538       548       558       568       578       588       598 |       -     | 618       628       638       648       658       668       678       688       698       708       718  
                                                                                                                                                                                 600           614                                                                                                          

Chain B from PDB  Type:PROTEIN  Length:259
 aligned with BRAF_HUMAN | P15056 from UniProtKB/Swiss-Prot  Length:766

    Alignment length:272
                                   458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718  
           BRAF_HUMAN   449 DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS 720
               SCOP domains d2fb8b_ B: automated matches                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2fb8B01 B:449-533 Phosphorylase Kinase; domain 1                                     2fb8B02 B:534-720 Transferase(Phosphotransferase) domain 1                                                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeee....eeeeee...eeeeee......hhhhhhhhhhhhhhhh.........eeeee.....eeeee.....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh............eeeehhheeee........-------------..hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh..............hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------------ISE-AASA---------------F-------------E-G-----------------------P-----C------------------------------------------------DD----K-------GLRR-RD-------------------------------------E----------------------------------------------------------------------R----------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------V-E--E-----------------------------N-K-------------------------------------------------------------------------------S--------------VV--E------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------V--R----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE --------------PROTEIN_KINASE_ATP   ----------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: B:449-478     ---------------------------Exon 1.14  PDB: B:506-565 UniProt: 506-565                  ---------------Exon 1.16  PDB: B:581-620 (gaps)        Exon 1.17  PDB: B:621-664 UniProt: 621-664  Exon 1.19  PDB: B:665-709 UniProt: 665-709   Exon 1.20d  Transcript 1 (1)
           Transcript 1 (2) -----------------------------Exon 1.13  PDB: B:478-506    ----------------------------------------------------------Exon 1.15a       ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2fb8 B 449 DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV-------------SGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS 720
                                   458       468       478       488       498       508       518       528       538       548       558       568       578       588       598 |       -     | 618       628       638       648       658       668       678       688       698       708       718  
                                                                                                                                                                                 600           614                                                                                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FB8)

(-) Gene Ontology  (64, 64)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (BRAF_HUMAN | P15056)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004709    MAP kinase kinase kinase activity    Catalysis of the phosphorylation and activation of a MAP kinase kinase; each MAP kinase kinase can be phosphorylated by any of several MAP kinase kinase kinases.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0031434    mitogen-activated protein kinase kinase binding    Interacting selectively and non-covalently with a mitogen-activated protein kinase kinase, any protein that can phosphorylate a MAP kinase.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0005057    signal transducer activity, downstream of receptor    Conveys a signal from an upstream receptor or intracellular signal transducer, converting the signal into a form where it can ultimately trigger a change in the state or activity of a cell.
    GO:0031267    small GTPase binding    Interacting selectively and non-covalently with a small monomeric GTPase.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0043367    CD4-positive, alpha-beta T cell differentiation    The process in which a relatively unspecialized T cell acquires specialized features of a mature CD4-positive, alpha-beta T cell.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000186    activation of MAPKK activity    The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
    GO:0046632    alpha-beta T cell differentiation    The process in which a precursor cell type acquires the specialized features of an alpha-beta T cell. An alpha-beta T cell is a T cell that expresses an alpha-beta T cell receptor complex.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0071277    cellular response to calcium ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0090150    establishment of protein localization to membrane    The directed movement of a protein to a specific location in a membrane.
    GO:0060324    face development    The biological process whose specific outcome is the progression of a face from an initial condition to its mature state. The face is the ventral division of the head.
    GO:0015758    glucose transport    The directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0060323    head morphogenesis    The process in which the anatomical structures of the head are generated and organized. The head is the anterior-most division of the body.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0060291    long-term synaptic potentiation    A process that modulates synaptic plasticity such that synapses are changed resulting in the increase in the rate, or frequency of synaptic transmission at the synapse.
    GO:0002318    myeloid progenitor cell differentiation    The process in which a precursor cell type acquires the specialized features of a myeloid progenitor cell. Myeloid progenitor cells include progenitor cells for any of the myeloid lineages.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:0010764    negative regulation of fibroblast migration    Any process that decreases the rate, frequency or extent of fibroblast cell migration. Fibroblast cell migration is accomplished by extension and retraction of a pseudopodium.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:2000301    negative regulation of synaptic vesicle exocytosis    Any process that stops, prevents or reduces the frequency, rate or extent of synaptic vesicle exocytosis.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043368    positive T cell selection    The process of sparing immature T cells which react with self-MHC protein complexes with low affinity levels from apoptotic death.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0048680    positive regulation of axon regeneration    Any process that activates, maintains or increases the rate of axon regeneration.
    GO:0050772    positive regulation of axonogenesis    Any process that activates or increases the frequency, rate or extent of axonogenesis.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0033138    positive regulation of peptidyl-serine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0051496    positive regulation of stress fiber assembly    Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0051291    protein heterooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0048679    regulation of axon regeneration    Any process that modulates the frequency, rate or extent of axon regeneration.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0051591    response to cAMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0043434    response to peptide hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0035019    somatic stem cell population maintenance    Any process by which an organism retains a population of somatic stem cells, undifferentiated cells in the embryo or adult which can undergo unlimited division and give rise to cell types of the body other than those of the germ-line.
    GO:0048538    thymus development    The process whose specific outcome is the progression of the thymus over time, from its formation to the mature structure. The thymus is a symmetric bi-lobed organ involved primarily in the differentiation of immature to mature T cells, with unique vascular, nervous, epithelial, and lymphoid cell components.
    GO:0030878    thyroid gland development    The process whose specific outcome is the progression of the thyroid gland over time, from its formation to the mature structure. The thyroid gland is an endoderm-derived gland that produces thyroid hormone.
    GO:0008542    visual learning    Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
cellular component
    GO:0044297    cell body    The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    215  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys A:522 - Pro A:523   [ RasMol ]  
    Lys B:522 - Pro B:523   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fb8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BRAF_HUMAN | P15056
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.37
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  114500
    Disease InformationOMIM
  115150
    Disease InformationOMIM
  211980
    Disease InformationOMIM
  605027
    Disease InformationOMIM
  613706
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BRAF_HUMAN | P15056
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BRAF_HUMAN | P150561uwh 1uwj 2l05 3c4c 3d4q 3idp 3ii5 3ny5 3og7 3ppj 3ppk 3prf 3pri 3psb 3psd 3q4c 3q96 3skc 3tv4 3tv6 4cqe 4dbn 4e26 4e4x 4ehe 4ehg 4fc0 4fk3 4g9c 4g9r 4h58 4jvg 4ksp 4ksq 4mbj 4mne 4mnf 4pp7 4r5y 4rzv 4rzw 4wo5 4xv1 4xv2 4xv3 4xv9 4yht 5c9c 5csw 5csx 5ct7 5fd2 5hi2 5hid 5hie 5ita 5j17 5j18 5j2r 5jrq 5jsm 5jt2 5val 5vam

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FB8)