Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF PROBABLE TRANSCRIPTIONAL REGULATOR PA0477 FROM PSEUDOMONAS AERUGINOSA
 
Authors :  V. V. Lunin, C. Chang, T. Skarina, E. Gorodischenskaya, A. M. Edwards, A. Joachimiak, A. Savchenko, Midwest Center For Structural Geno (Mcsg)
Date :  26 Oct 05  (Deposition) - 01 Nov 05  (Release) - 05 Oct 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Pa0477, Apc5828, Transcription, Regulator, Psi, Protein Structure Initiative, Mcsg, Midwest Center For Structural Genomics, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. V. Lunin, C. Chang, T. Skarina, E. Gorodischenskaya, A. Joachimiak A. Edwards, A. Savchenko
The Crystal Structure Of Putative Transcriptional Regulator Pa0477 From Pseudomonas Aeruginosa
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROBABLE TRANSCRIPTIONAL REGULATOR
    Chains: A, C, B, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: MODIFIED PET15B
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 287

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ESN)

(-) Sites  (0, 0)

(no "Site" information available for 2ESN)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ESN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ESN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ESN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2ESN)

(-) Exons   (0, 0)

(no "Exon" information available for 2ESN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:299
 aligned with Q9I641_PSEAE | Q9I641 from UniProtKB/TrEMBL  Length:308

    Alignment length:301
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302 
         Q9I641_PSEAE     3 PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLD 303
               SCOP domains d2esna1 A:3-91 Probable LysR-type transcriptional regulator PA0477                       d2esna2 A:92-303 Probable LysR-type transcriptional regulator PA0477                                                                                                                                                 SCOP domains
               CATH domains 2esnA01 A:3-91 'winged helix' repressor DNA binding domain                               2esnA02 A:92-175,A:275-303 Periplasmic binding protein-like II                      2esnA03 A:176-274 Periplasmic binding protein-like II                                              2esnA02 A:9  2-175,A:275-303  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...eeee..eeeehhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeee.hhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhhh...eeee...........eeeeeeeee.eeeeee..........hhhhhhh.eeeee.......hhhhhhhhhh....eeeeee.hhhhhhhhhhh...eeeeehhhhhhhhhhhheeee........eeeeeeee..--.hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2esn A   3 PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQ--GRDAHAWMIGQLKGLD 303
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282  |  | 292       302 
                                                                                                                                                                                                                                                                                                                    285  |               
                                                                                                                                                                                                                                                                                                                       288               


Chain B from PDB  Type:PROTEIN  Length:300
 aligned with Q9I641_PSEAE | Q9I641 from UniProtKB/TrEMBL  Length:308

    Alignment length:304
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301    
         Q9I641_PSEAE     2 HPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLDIS 305
               SCOP domains d2esnb1 B:2-91 Probable LysR-type transcriptional regulator PA0477                        d2esnb2 B:92-305 Probable LysR-type transcriptional regulator PA0477                                                                                                                                                   SCOP domains
               CATH domains 2esnB01 B:2-91 'winged helix' repressor DNA binding domain                                2esnB02 B:92-175,B:275-305 Periplasmic binding protein-like II                      2esnB03 B:176-274 Periplasmic binding protein-like II                                              2esnB02 B:9    2-175,B:275-305  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh...eeee..eeeehhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeehhhhhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhh....eeeee..........eeeeeeeee.eeeeee..........hhhhhhh.eeeee.......hhhhhhhhh.....eeeeee.hhhhhhhhhhh...eeeeehhhhhhhhhhhheeee........eeeeeeee..----hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2esn B   2 HPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQ----DAHAWMIGQLKGLDIS 305
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281   |   291       301    
                                                                                                                                                                                                                                                                                                                     285  290               


Chain C from PDB  Type:PROTEIN  Length:298
 aligned with Q9I641_PSEAE | Q9I641 from UniProtKB/TrEMBL  Length:308

    Alignment length:304
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301    
         Q9I641_PSEAE     2 HPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLDIS 305
               SCOP domains d2esnc1 C:2-91 Probable LysR-type transcriptional regulator PA0477                        d2esnc2 C:92-305 Probable LysR-type transcriptional regulator PA0    477                                                                                                                                               SCOP domains
               CATH domains 2esnC01 C:2-93 'winged helix' repressor DNA binding domain                                  2esnC02 C:94-175,C:275-305 Periplasmic binding protein-like II                    2esnC03 C:176-274 Periplasmic binding protein-like II                                              2esnC02 C:94  -175,C:275-305    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....eeee..eeeehhhhhhhhhhhhhhhhhhhhhhhh...........eeeee.hhhhhhhhhhhhhhhhhhhh...eeeee......hhhhhhh....eeeee.----.....eeeeeeeee.eeeeee..........hhhhhhh.eeeee.......hhhhhhhhh.....eeeeee.hhhhhhhhhhh...eeeeehhhhhhhhhhhheeee........eeeeeeee...--hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2esn C   2 HPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYD----RLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQH--RDAHAWMIGQLKGLDIS 305
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151    |  161       171       181       191       201       211       221       231       241       251       261       271       281    |  291       301    
                                                                                                                                                                                    156  161                                                                                                                          286  |                
                                                                                                                                                                                                                                                                                                                         289                


Chain D from PDB  Type:PROTEIN  Length:298
 aligned with Q9I641_PSEAE | Q9I641 from UniProtKB/TrEMBL  Length:308

    Alignment length:301
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302 
         Q9I641_PSEAE     3 PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLD 303
               SCOP domains d2esnd1 D:3-91 Probable LysR-type transcriptional regulator PA0477                       d2esnd2 D:92-303 Probable LysR-type transcriptional regulator PA0477                                                                                                                                                 SCOP domains
               CATH domains 2esnD01 D:3-93 'winged helix' repressor DNA binding domain                                 2esnD02 D:94-175,D:275-303 Periplasmic binding protein-like II                    2esnD03 D:176-274 Periplasmic binding protein-like II                                              2esnD02 D:9   4-175,D:275-303 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...eee....eeehhhhhhhhhhhhhhhhhhhhhhhhhh.........eeeeeehhhhhhhhhhhhhhhhhhhh...eeeeee......hhhhhh....eeee...........eeeeeeeee.eeeeee..........hhhhhhhheeeee.......hhhhhhhhh.....eeeeee.hhhhhhhhhhh...eeeeehhhhhhhhhhhheeee........eeeeeeee..---hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2esn D   3 PLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQ---RDAHAWMIGQLKGLD 303
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282  |   |292       302 
                                                                                                                                                                                                                                                                                                                    285 289
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 12)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Architecture: 3-Layer(aba) Sandwich (12045)
(-)
Topology: D-Maltodextrin-Binding Protein; domain 2 (600)
(-)
Homologous Superfamily: Periplasmic binding protein-like II (486)
(-)
Pseudomonas aeruginosa. Organism_taxid: 287. (1)
1a2esnA02A:92-175,A:275-303
1b2esnB02B:92-175,B:275-305
1c2esnD02D:94-175,D:275-303
1d2esnC02C:94-175,C:275-305
1e2esnA03A:176-274
1f2esnB03B:176-274
1g2esnC03C:176-274
1h2esnD03D:176-274
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ESN)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (Q9I641_PSEAE | Q9I641)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2esn)
 
  Sites
(no "Sites" information available for 2esn)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2esn)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2esn
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9I641_PSEAE | Q9I641
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9I641_PSEAE | Q9I641
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2ESN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ESN)