Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RUH-072, AN APO-BIOTNYL DOMAIN FORM HUMAN ACETYL COENZYME A CARBOXYLASE
 
Authors :  A. Z. M. Ruhul Momen, H. Hirota, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  19 Mar 07  (Deposition) - 25 Sep 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Biotin-Requiring Enzyme, Biotin, Actyl Coa Carboxylase, Fatty Acid Synthesis, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Z. M. Ruhul Momen, H. Hirota, F. Hayashi, S. Yokoyama
Solution Structure Of Ruh-072, An Apo-Biotnyl Domain Form Human Acetyl Coenzyme A Carboxylase
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - METHYLCROTONOYL-COA CARBOXYLASE SUBUNIT ALPHA
    ChainsA
    EC Number6.4.1.4
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPO50719-21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN OF ACETYL COA CARBOXYLASE
    GeneMCCC1, MCCA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EJM)

(-) Sites  (0, 0)

(no "Site" information available for 2EJM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2EJM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2EJM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EJM)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BIOTINYL_LIPOYLPS50968 Biotinyl/lipoyl domain profile.MCCA_HUMAN643-715  1A:11-83
2BIOTINPS00188 Biotin-requiring enzymes attachment site.MCCA_HUMAN671-688  1A:39-56

(-) Exons   (5, 5)

NMR Structure (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000002655942aENSE00001887323chr3:182817375-182817140236MCCA_HUMAN1-30300--
1.4bENST000002655944bENSE00001654055chr3:182812393-18281234747MCCA_HUMAN30-46170--
1.5aENST000002655945aENSE00001684852chr3:182810333-182810197137MCCA_HUMAN46-91460--
1.7aENST000002655947aENSE00001635236chr3:182804576-18280448196MCCA_HUMAN92-123320--
1.8bENST000002655948bENSE00001277966chr3:182790275-182790154122MCCA_HUMAN124-164410--
1.9bENST000002655949bENSE00000780963chr3:182789145-182788998148MCCA_HUMAN164-213500--
1.10dENST0000026559410dENSE00000836709chr3:182788908-182788787122MCCA_HUMAN214-254410--
1.11ENST0000026559411ENSE00001126825chr3:182775210-182775099112MCCA_HUMAN254-291380--
1.12ENST0000026559412ENSE00000836712chr3:182770028-18276994782MCCA_HUMAN292-319280--
1.13ENST0000026559413ENSE00000836713chr3:182763328-182763201128MCCA_HUMAN319-361430--
1.14ENST0000026559414ENSE00000780966chr3:182759538-182759355184MCCA_HUMAN362-423620--
1.15ENST0000026559415ENSE00000836715chr3:182756923-182756814110MCCA_HUMAN423-459370--
1.16bENST0000026559416bENSE00001277913chr3:182755222-182755006217MCCA_HUMAN460-532730--
1.17ENST0000026559417ENSE00001139613chr3:182751865-18275177987MCCA_HUMAN532-561301A:1-44
1.19ENST0000026559419ENSE00000836718chr3:182743592-18274354350MCCA_HUMAN561-577170--
1.20cENST0000026559420cENSE00000780971chr3:182740342-182740205138MCCA_HUMAN578-623461A:5-73
1.21bENST0000026559421bENSE00000836720chr3:182738025-182737918108MCCA_HUMAN624-659361A:8-2720
1.22ENST0000026559422ENSE00000780973chr3:182735125-18273505472MCCA_HUMAN660-683241A:28-5124
1.23dENST0000026559423dENSE00001869985chr3:182733354-182733006349MCCA_HUMAN684-725421A:52-9342

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:99
 aligned with MCCA_HUMAN | Q96RQ3 from UniProtKB/Swiss-Prot  Length:725

    Alignment length:193
                                                                                                                                                                                                                    725      
                                   548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708       718      |  -   
           MCCA_HUMAN   539 SSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLFSKEGSIEIDIPVPKYLSSVSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE------   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------2ejmA01 A:17-84  [code=2.40.50.100, no name defined]                --------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....------------------------------------------------...----------------------------------------------...............eeeeee.....eee....eeeeee....eeeee....eeeeee.....eee......eee................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------------------------------------BIOTINYL_LIPOYL  PDB: A:11-83 UniProt: 643-715                           ---------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------BIOTIN            ------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.17  PDB: A:1-4  ----------------Exon 1.20c  PDB: A:5-7 UniProt: 578-623       Exon 1.21b  PDB: A:8-27 [INCOMPLETE]Exon 1.22  PDB: A:28-51 Exon 1.23d  PDB: A:52-93 UniProt: 684-725 ------ Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.19  PDB: ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2ejm A   1 GSSG------------------------------------------------SSG----------------------------------------------VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESESGPSSG  99
                               |     -         -         -         -         -  | |    -         -         -         -         - |      16        26        36        46        56        66        76        86        96   
                               4                                                5 7                                              8                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2EJM)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EJM)

(-) Gene Ontology  (16, 16)

NMR Structure(hide GO term definitions)
Chain A   (MCCA_HUMAN | Q96RQ3)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0009374    biotin binding    Interacting selectively and non-covalently with biotin (cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid), the (+) enantiomer of which is very widely distributed in cells and serves as a carrier in a number of enzymatic beta-carboxylation reactions.
    GO:0004075    biotin carboxylase activity    Catalysis of the reaction: ATP + biotin-carboxyl-carrier protein + CO2 = ADP + phosphate + carboxybiotin-carboxyl-carrier protein.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004485    methylcrotonoyl-CoA carboxylase activity    Catalysis of the reaction: 3-methylbut-2-enoyl-CoA + ATP + bicarbonate = trans-3-methylglutaconyl-CoA + ADP + 2 H(+) + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006768    biotin metabolic process    The chemical reactions and pathways involving biotin, cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid; the (+) enantiomer is very widely distributed in cells and serves as a carrier in a number of enzymatic beta-carboxylation reactions.
    GO:0009083    branched-chain amino acid catabolic process    The chemical reactions and pathways resulting in the breakdown of amino acids containing a branched carbon skeleton, comprising isoleucine, leucine and valine.
    GO:0006552    leucine catabolic process    The chemical reactions and pathways resulting in the breakdown of leucine, 2-amino-4-methylpentanoic acid.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005743    mitochondrial inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ejm)
 
  Sites
(no "Sites" information available for 2ejm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ejm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ejm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MCCA_HUMAN | Q96RQ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.4.1.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MCCA_HUMAN | Q96RQ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2EJM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2EJM)