Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE YEAST SEC2P GEF DOMAIN
 
Authors :  S. Fukai, Y. Sato, O. Nureki
Date :  12 Jan 07  (Deposition) - 27 Feb 07  (Release) - 02 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Biol. Unit 5:  I,J  (1x)
Biol. Unit 6:  K,L  (1x)
Biol. Unit 7:  M,N  (1x)
Biol. Unit 8:  O,P  (1x)
Biol. Unit 9:  Q,R  (1x)
Biol. Unit 10:  S,T  (1x)
Keywords :  Coiled Coil, Endocytosis/Exocytosis Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Sato, R. Shirakawa, H. Horiuchi, N. Dohmae, S. Fukai, O. Nureki
Asymmetric Coiled-Coil Structure With Guanine Nucleotide Exchange Activity
Structure V. 15 245 2007
PubMed-ID: 17292842  |  Reference-DOI: 10.1016/J.STR.2007.01.003
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    ChainsA, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX6P1
    Expression System StrainB834
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentGEF DOMAIN, RESIDUES 31-160
    MutationYES
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymGDP-GTP EXCHANGE FACTOR SEC2

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920
Asymmetric Unit ABCDEFGHIJKLMNOPQRST
Biological Unit 1 (1x)AB                  
Biological Unit 2 (1x)  CD                
Biological Unit 3 (1x)    EF              
Biological Unit 4 (1x)      GH            
Biological Unit 5 (1x)        IJ          
Biological Unit 6 (1x)          KL        
Biological Unit 7 (1x)            MN      
Biological Unit 8 (1x)              OP    
Biological Unit 9 (1x)                QR  
Biological Unit 10 (1x)                  ST

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 34)

Asymmetric Unit (1, 34)
No.NameCountTypeFull Name
1MSE34Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 5 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 6 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 7 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 8 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 9 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 10 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2E7S)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2E7S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2E7S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2E7S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2E7S)

(-) Exons   (1, 20)

Asymmetric Unit (1, 20)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YNL272C1YNL272C.1XIV:129084-1268052280SEC2_YEAST1-75975920A:31-144
B:31-151
C:31-148
D:31-154
E:31-154
F:31-154
G:31-140
H:31-137
I:31-144
J:31-137
K:31-147
L:31-144
M:31-147
N:31-141
O:31-154
P:31-144
Q:31-141
R:31-141
S:31-147
T:31-144
114
121
118
124
124
124
110
107
114
107
117
114
117
111
124
114
111
111
117
114

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:114
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:114
                                    40        50        60        70        80        90       100       110       120       130       140    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLL 144
               SCOP domains d2e7sa1 A:31-144 Rab guanine nucleotide exchange factor Sec2                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: A:31-144 UniProt: 1-759 [INCOMPLETE]                                                                Transcript 1
                 2e7s A  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLL 144
                                    40        50        60        70        80        90       100       110       120|      130       140 |  
                                                                                                                    121-MSE              142-MSE

Chain B from PDB  Type:PROTEIN  Length:121
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:121
                                    40        50        60        70        80        90       100       110       120       130       140       150 
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQL 151
               SCOP domains d2e7sb_ B: automated matches                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:31-151 UniProt: 1-759 [INCOMPLETE]                                                                       Transcript 1
                 2e7s B  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTLTLQL 151
                                    40        50        60        70        80        90       100       110       120|      130       140 |     150 
                                                                                                                    121-MSE              142-MSE     

Chain C from PDB  Type:PROTEIN  Length:118
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:118
                                    40        50        60        70        80        90       100       110       120       130       140        
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLT 148
               SCOP domains d2e7sc_ C: automated matches                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:31-148 UniProt: 1-759 [INCOMPLETE]                                                                    Transcript 1
                 2e7s C  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTLT 148
                                    40        50        60        70        80        90       100       110       120|      130       140 |      
                                                                                                                    121-MSE              142-MSE  

Chain D from PDB  Type:PROTEIN  Length:124
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:124
                                    40        50        60        70        80        90       100       110       120       130       140       150    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNL 154
               SCOP domains d2e7sd_ D: automated matches                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: D:31-154 UniProt: 1-759 [INCOMPLETE]                                                                          Transcript 1
                 2e7s D  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTLTLQLKNL 154
                                    40        50        60        70        80        90       100       110       120|      130       140 |     150    
                                                                                                                    121-MSE              142-MSE        

Chain E from PDB  Type:PROTEIN  Length:124
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:124
                                    40        50        60        70        80        90       100       110       120       130       140       150    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNL 154
               SCOP domains d2e7se_ E: automated matches                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: E:31-154 UniProt: 1-759 [INCOMPLETE]                                                                          Transcript 1
                 2e7s E  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTLTLQLKNL 154
                                    40        50        60        70        80        90       100       110       120|      130       140 |     150    
                                                                                                                    121-MSE              142-MSE        

Chain F from PDB  Type:PROTEIN  Length:124
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:124
                                    40        50        60        70        80        90       100       110       120       130       140       150    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNL 154
               SCOP domains d2e7sf_ F: automated matches                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: F:31-154 UniProt: 1-759 [INCOMPLETE]                                                                          Transcript 1
                 2e7s F  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTLTLQLKNL 154
                                    40        50        60        70        80        90       100       110       120|      130       140 |     150    
                                                                                                                    121-MSE              142-MSE        

Chain G from PDB  Type:PROTEIN  Length:110
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:110
                                    40        50        60        70        80        90       100       110       120       130       140
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREK 140
               SCOP domains d2e7sg_ G: automated matches                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: G:31-140 UniProt: 1-759 [INCOMPLETE]                                                            Transcript 1
                 2e7s G  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREK 140
                                    40        50        60        70        80        90       100       110       120|      130       140
                                                                                                                    121-MSE               

Chain H from PDB  Type:PROTEIN  Length:107
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:107
                                    40        50        60        70        80        90       100       110       120       130       
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQL 137
               SCOP domains d2e7sh_ H: automated matches                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: H:31-137 UniProt: 1-759 [INCOMPLETE]                                                         Transcript 1
                 2e7s H  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQL 137
                                    40        50        60        70        80        90       100       110       120|      130       
                                                                                                                    121-MSE            

Chain I from PDB  Type:PROTEIN  Length:114
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:114
                                    40        50        60        70        80        90       100       110       120       130       140    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLL 144
               SCOP domains d2e7si1 I:31-144 Rab guanine nucleotide exchange factor Sec2                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh...hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: I:31-144 UniProt: 1-759 [INCOMPLETE]                                                                Transcript 1
                 2e7s I  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLL 144
                                    40        50        60        70        80        90       100       110       120|      130       140 |  
                                                                                                                    121-MSE              142-MSE

Chain J from PDB  Type:PROTEIN  Length:107
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:107
                                    40        50        60        70        80        90       100       110       120       130       
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQL 137
               SCOP domains d2e7sj1 J:31-137 Rab guanine nucleotide exchange factor Sec2                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: J:31-137 UniProt: 1-759 [INCOMPLETE]                                                         Transcript 1
                 2e7s J  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQL 137
                                    40        50        60        70        80        90       100       110       120|      130       
                                                                                                                    121-MSE            

Chain K from PDB  Type:PROTEIN  Length:117
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:117
                                    40        50        60        70        80        90       100       110       120       130       140       
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTL 147
               SCOP domains d2e7sk1 K:31-144 Rab guanine nucleotide exchange factor Sec2                                                      --- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: K:31-147 UniProt: 1-759 [INCOMPLETE]                                                                   Transcript 1
                 2e7s K  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTL 147
                                    40        50        60        70        80        90       100       110       120|      130       140 |     
                                                                                                                    121-MSE              142-MSE 

Chain L from PDB  Type:PROTEIN  Length:114
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:114
                                    40        50        60        70        80        90       100       110       120       130       140    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLL 144
               SCOP domains d2e7sl1 L:31-144 Rab guanine nucleotide exchange factor Sec2                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: L:31-144 UniProt: 1-759 [INCOMPLETE]                                                                Transcript 1
                 2e7s L  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLL 144
                                    40        50        60        70        80        90       100       110       120|      130       140 |  
                                                                                                                    121-MSE              142-MSE

Chain M from PDB  Type:PROTEIN  Length:117
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:117
                                    40        50        60        70        80        90       100       110       120       130       140       
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTL 147
               SCOP domains d2e7sm1 M:31-144 Rab guanine nucleotide exchange factor Sec2                                                      --- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: M:31-147 UniProt: 1-759 [INCOMPLETE]                                                                   Transcript 1
                 2e7s M  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTL 147
                                    40        50        60        70        80        90       100       110       120|      130       140 |     
                                                                                                                    121-MSE              142-MSE 

Chain N from PDB  Type:PROTEIN  Length:111
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:111
                                    40        50        60        70        80        90       100       110       120       130       140 
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKD 141
               SCOP domains d2e7sn1 N:31-141 Rab guanine nucleotide exchange factor Sec2                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: N:31-141 UniProt: 1-759 [INCOMPLETE]                                                             Transcript 1
                 2e7s N  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKD 141
                                    40        50        60        70        80        90       100       110       120|      130       140 
                                                                                                                    121-MSE                

Chain O from PDB  Type:PROTEIN  Length:124
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:124
                                    40        50        60        70        80        90       100       110       120       130       140       150    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNL 154
               SCOP domains d2e7so1 O:31-144 Rab guanine nucleotide exchange factor Sec2                                                      ---------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: O:31-154 UniProt: 1-759 [INCOMPLETE]                                                                          Transcript 1
                 2e7s O  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTLTLQLKNL 154
                                    40        50        60        70        80        90       100       110       120|      130       140 |     150    
                                                                                                                    121-MSE              142-MSE        

Chain P from PDB  Type:PROTEIN  Length:114
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:114
                                    40        50        60        70        80        90       100       110       120       130       140    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLL 144
               SCOP domains d2e7sp1 P:31-144 Rab guanine nucleotide exchange factor Sec2                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: P:31-144 UniProt: 1-759 [INCOMPLETE]                                                                Transcript 1
                 2e7s P  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLL 144
                                    40        50        60        70        80        90       100       110       120|      130       140 |  
                                                                                                                    121-MSE              142-MSE

Chain Q from PDB  Type:PROTEIN  Length:111
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:111
                                    40        50        60        70        80        90       100       110       120       130       140 
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKD 141
               SCOP domains d2e7sq1 Q:31-141 Rab guanine nucleotide exchange factor Sec2                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: Q:31-141 UniProt: 1-759 [INCOMPLETE]                                                             Transcript 1
                 2e7s Q  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKD 141
                                    40        50        60        70        80        90       100       110       120|      130       140 
                                                                                                                    121-MSE                

Chain R from PDB  Type:PROTEIN  Length:111
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:111
                                    40        50        60        70        80        90       100       110       120       130       140 
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKD 141
               SCOP domains d2e7sr1 R:31-141 Rab guanine nucleotide exchange factor Sec2                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: R:31-141 UniProt: 1-759 [INCOMPLETE]                                                             Transcript 1
                 2e7s R  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKD 141
                                    40        50        60        70        80        90       100       110       120|      130       140 
                                                                                                                    121-MSE                

Chain S from PDB  Type:PROTEIN  Length:117
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:117
                                    40        50        60        70        80        90       100       110       120       130       140       
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTL 147
               SCOP domains d2e7ss1 S:31-144 Rab guanine nucleotide exchange factor Sec2                                                      --- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: S:31-147 UniProt: 1-759 [INCOMPLETE]                                                                   Transcript 1
                 2e7s S  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLLDTL 147
                                    40        50        60        70        80        90       100       110       120|      130       140 |     
                                                                                                                    121-MSE              142-MSE 

Chain T from PDB  Type:PROTEIN  Length:114
 aligned with SEC2_YEAST | P17065 from UniProtKB/Swiss-Prot  Length:759

    Alignment length:114
                                    40        50        60        70        80        90       100       110       120       130       140    
           SEC2_YEAST    31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDTLL 144
               SCOP domains d2e7st1 T:31-144 Rab guanine nucleotide exchange factor Sec2                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: T:31-144 UniProt: 1-759 [INCOMPLETE]                                                                Transcript 1
                 2e7s T  31 LEEQLNKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARmEKYAIEILNKRLTEQLREKDmLL 144
                                    40        50        60        70        80        90       100       110       120|      130       140 |  
                                                                                                                    121-MSE              142-MSE

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 20)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2E7S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2E7S)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T   (SEC2_YEAST | P17065)
molecular function
    GO:0005085    guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0070273    phosphatidylinositol-4-phosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-4-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 4' position.
biological process
    GO:0006914    autophagy    The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
    GO:0006887    exocytosis    A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005935    cellular bud neck    The constriction between the mother cell and daughter cell (bud) in an organism that reproduces by budding.
    GO:0005934    cellular bud tip    The end of a cellular bud distal to the site of attachment to the mother cell.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0030133    transport vesicle    Any of the vesicles of the constitutive secretory pathway, which carry cargo from the endoplasmic reticulum to the Golgi, between Golgi cisternae, from the Golgi to the ER (retrograde transport) or to destinations within or outside the cell.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2e7s)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2e7s)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2e7s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SEC2_YEAST | P17065
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SEC2_YEAST | P17065
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SEC2_YEAST | P170652eqb 2ocy 4zdw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2E7S)