2E5N - JenaLib

NMR Structure - manually

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE ELL_N2 DOMAIN OF TARGET OF RNA POLYMERASE II ELONGATION FACTOR ELL2

Authors :   W. Dang, Y. Muto, M. Inoue, T. Kigawa, M. Shirouzu, T. Terada, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   22 Dec 06 (Deposition) - 26 Jun 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Nmr, Ell_n2 Domain, Rna Polymerase Ii Elongation Factor Ell2, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Dang, Y. Muto, M. Inoue, T. Kigawa, M. Shirouzu, T. Terada, S. Yokoyama
Solution Structure Of The Ell_n2 Domain Of Target Of Rna Polymerase Ii Elongation Factor Ell2
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - RNA POLYMERASE II ELONGATION FACTOR ELL2
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P060508-09
	Expression System Vector Type	:	PLASMID
	Fragment	:	ELL_N2 DOMAIN
	Gene	:	ELL2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2E5N)

Sites (0, 0)

(no "Site" information available for 2E5N)

SS Bonds (0, 0)

(no "SS Bond" information available for 2E5N)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2E5N)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2E5N)

PROSITE Motifs (0, 0)

(no "PROSITE Motif" information available for 2E5N)

Exons (3, 3)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000237853	1a	ENSE00001250185	chr5:95297775-95297279	497	ELL2_HUMAN	1-49	49	0	-	-
1.2a	ENST00000237853	2a	ENSE00000908286	chr5:95278753-95278706	48	ELL2_HUMAN	50-65	16	0	-	-
1.3	ENST00000237853	3	ENSE00000972116	chr5:95255249-95255128	122	ELL2_HUMAN	66-106	41	0	-	-
1.4b	ENST00000237853	4b	ENSE00000972117	chr5:95249638-95249475	164	ELL2_HUMAN	106-161	56	0	-	-
1.5b	ENST00000237853	5b	ENSE00000972118	chr5:95242486-95242227	260	ELL2_HUMAN	161-247	87	1	A:1-55	55
1.6b	ENST00000237853	6b	ENSE00000972119	chr5:95236784-95236660	125	ELL2_HUMAN	248-289	42	1	A:56-97	42
1.7a	ENST00000237853	7a	ENSE00000972120	chr5:95236484-95236397	88	ELL2_HUMAN	289-318	30	1	A:97-100	4
1.8c	ENST00000237853	8c	ENSE00000972121	chr5:95234514-95233944	571	ELL2_HUMAN	319-509	191	0	-	-
1.9	ENST00000237853	9	ENSE00000972122	chr5:95231395-95231332	64	ELL2_HUMAN	509-530	22	0	-	-
1.10a	ENST00000237853	10a	ENSE00000972123	chr5:95226978-95226807	172	ELL2_HUMAN	530-587	58	0	-	-
1.11	ENST00000237853	11	ENSE00000972124	chr5:95224834-95224790	45	ELL2_HUMAN	588-602	15	0	-	-
1.12b	ENST00000237853	12b	ENSE00001889032	chr5:95224691-95220802	3890	ELL2_HUMAN	603-640	38	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:100
 aligned with ELL2_HUMAN | O00472 from UniProtKB/Swiss-Prot  Length:640

    Alignment length:100
                                   202       212       222       232       242       252       262       272       282       292
           ELL2_HUMAN   193 RKTHSSSTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN 292
               SCOP domains d2e5na_ A: automated matches                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhh....hhhhhhhhhhh...hhhhhhhhhhhhhheeee....eeee...hhhh...........hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5b  PDB: A:1-55 UniProt: 161-247 [INCOMPLETE]   Exon 1.6b  PDB: A:56-97 UniProt: 248-289  --- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------1.7a Transcript 1 (2)
                 2e5n A   1 GSSGSSGTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN 100
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: DNA/RNA-binding 3-helical bundle (1299)

Superfamily: Winged helix DNA-binding domain (576)

Family: ELL N2 domain-like (2)

Protein domain: automated matches (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d2e5na_

CATH Domains (0, 0)

(no "CATH Domain" information available for 2E5N)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 2E5N)

Gene Ontology (9, 9)

NMR Structure(hide GO term definitions)

Chain A (ELL2_HUMAN | O00472)

biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042795	snRNA transcription from RNA polymerase II promoter	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0008023	transcription elongation factor complex	Any protein complex that interacts with RNA polymerase II to increase (positive transcription elongation factor) or reduce (negative transcription elongation factor) the rate of transcription elongation.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2e5n)

	Sites
(no "Sites" information available for 2e5n)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2e5n)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2e5n
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ELL2_HUMAN \| O00472
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ELL2_HUMAN \| O00472
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	ELL2_HUMAN \| O00472	:	5jw9

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2E5N)