|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric/Biological Unit (3, 5) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2D9R) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D9R) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2D9R) |
Exons (0, 0)| (no "Exon" information available for 2D9R) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:85 aligned with Q7MXL1_PORGI | Q7MXL1 from UniProtKB/TrEMBL Length:104 Alignment length:85 29 39 49 59 69 79 89 99 Q7MXL1_PORGI 20 SPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL 104 SCOP domains d2d9ra1 A:20-104 Hypothetical protein PG0164 SCOP domains CATH domains 2d9rA00 A:20-104 AF2212/PG0164-like domains CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2d9r A 20 SPIEFDAIIRQVPDmDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRmGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL 104 29 | 39 49 59 69 | 79 89 99 34-MSE 72-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D9R) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2D9R)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|