|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2D5D) |
Sites (0, 0)| (no "Site" information available for 2D5D) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2D5D) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2D5D) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D5D) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2D5D) |
Exons (0, 0)| (no "Exon" information available for 2D5D) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:70 aligned with O59021_PYRHO | O59021 from UniProtKB/TrEMBL Length:149 Alignment length:70 89 99 109 119 129 139 149 O59021_PYRHO 80 ENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG 149 SCOP domains ---------------------------------------------------------------------- SCOP domains CATH domains 2d5dA00 A:77-146 [code=2.40.50.100, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2d5d A 77 ENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG 146 86 96 106 116 126 136 146 Chain B from PDB Type:PROTEIN Length:70 aligned with O59021_PYRHO | O59021 from UniProtKB/TrEMBL Length:149 Alignment length:70 89 99 109 119 129 139 149 O59021_PYRHO 80 ENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG 149 SCOP domains ---------------------------------------------------------------------- SCOP domains CATH domains 2d5dB00 B:77-146 [code=2.40.50.100, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2d5d B 77 ENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG 146 86 96 106 116 126 136 146
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2D5D) |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D5D) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2D5D)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|