2D06 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN SULT1A1 COMPLEXED WITH PAP AND ESTRADIOL

Authors :   N. U. Gamage, S. Tsvetanov, R. G. Duggleby, M. E. Mcmanus, J. L. Martin

Date :   25 Jul 05 (Deposition) - 25 Oct 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Sult 1A1, Pap, Estradiol, Substrarte Inhibition, Dead End Complex, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. U. Gamage, S. Tsvetanov, R. G. Duggleby, M. E. Mcmanus, J. L. Martin
The Structure Of Human Sult1A1 Crystallized With Estradiol. An Insight Into Active Site Plasticity And Substrate Inhibition With Multi-Ring Substrates
J. Biol. Chem. V. 280 41482 2005
PubMed-ID: 16221673 | Reference-DOI: 10.1074/JBC.M508289200
(for further references see the PDB file header)

Molecule 1 - SULFOTRANSFERASE 1A1
	Chains	:	A, B
	EC Number	:	2.8.2.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET20A+
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	SULT1A1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SULT1A1, PHENOL SULFOTRANSFERASE 1, ARYL SULFOTRANSFERASE 1, PHENOL-SULFATING PHENOL SULFOTRANSFERASE 1, P- PST 1, THERMOSTABLE PHENOL SULFOTRANSFERASE, TS-PST, HAST1/HAST2, ST1A3
	Tissue	:	LIVER

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE
2	EST	2	Ligand/Ion	ESTRADIOL

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	A3P	1	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE
2	EST	1	Ligand/Ion	ESTRADIOL

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	A3P	1	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE
2	EST	1	Ligand/Ion	ESTRADIOL

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:48 , SER A:49 , GLY A:50 , THR A:51 , THR A:52 , TRP A:53 , ARG A:130 , SER A:138 , TYR A:193 , THR A:227 , PHE A:229 , MET A:232 , PHE A:255 , MET A:256 , ARG A:257 , LYS A:258 , GLY A:259 , EST A:304 , HOH A:3032 , HOH A:3042 , HOH A:3043 , HOH A:3074	BINDING SITE FOR RESIDUE A3P A 2001
2	AC2	SOFTWARE	LYS B:48 , SER B:49 , GLY B:50 , THR B:51 , THR B:52 , TRP B:53 , ARG B:130 , SER B:138 , TYR B:193 , THR B:227 , SER B:228 , PHE B:229 , MET B:232 , PHE B:255 , MET B:256 , ARG B:257 , LYS B:258 , GLY B:259 , EST B:305 , HOH B:3003 , HOH B:3004 , HOH B:3078	BINDING SITE FOR RESIDUE A3P B 2002
3	AC3	SOFTWARE	PRO A:47 , LYS A:48 , LYS A:106 , HIS A:108 , ALA A:146 , VAL A:148 , PHE A:247 , A3P A:2001	BINDING SITE FOR RESIDUE EST A 304
4	AC4	SOFTWARE	PHE B:24 , PRO B:47 , LYS B:48 , LYS B:106 , HIS B:108 , VAL B:148 , TYR B:240 , PHE B:247 , A3P B:2002	BINDING SITE FOR RESIDUE EST B 305

(no "SS Bond" information available for 2D06)

Asymmetric Unit

No.	Residues
1	Ala A:101	-	Pro A:102
2	Ala B:101	-	Pro B:102

Asymmetric Unit (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_009302	R	37	Q	ST1A1_HUMAN	Polymorphism	143283780	A/B	R	37	Q
2	UniProt	VAR_028721	E	151	D	ST1A1_HUMAN	Polymorphism	1042014	A/B	E	151	D
3	UniProt	VAR_057339	E	151	Q	ST1A1_HUMAN	Polymorphism	1042011	A/B	E	151	Q
4	UniProt	VAR_007425	R	213	H	ST1A1_HUMAN	Polymorphism	9282861	A/B	H	213	H
5	UniProt	VAR_009303	V	223	M	ST1A1_HUMAN	Polymorphism	1801030	A/B	M	223	M
6	UniProt	VAR_014889	N	235	T	ST1A1_HUMAN	Polymorphism	35728980	A/B	N	235	T
7	UniProt	VAR_061886	E	282	K	ST1A1_HUMAN	Polymorphism	36043491	A/B	E	282	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_009302	R	37	Q	ST1A1_HUMAN	Polymorphism	143283780	A	R	37	Q
2	UniProt	VAR_028721	E	151	D	ST1A1_HUMAN	Polymorphism	1042014	A	E	151	D
3	UniProt	VAR_057339	E	151	Q	ST1A1_HUMAN	Polymorphism	1042011	A	E	151	Q
4	UniProt	VAR_007425	R	213	H	ST1A1_HUMAN	Polymorphism	9282861	A	H	213	H
5	UniProt	VAR_009303	V	223	M	ST1A1_HUMAN	Polymorphism	1801030	A	M	223	M
6	UniProt	VAR_014889	N	235	T	ST1A1_HUMAN	Polymorphism	35728980	A	N	235	T
7	UniProt	VAR_061886	E	282	K	ST1A1_HUMAN	Polymorphism	36043491	A	E	282	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_009302	R	37	Q	ST1A1_HUMAN	Polymorphism	143283780	B	R	37	Q
2	UniProt	VAR_028721	E	151	D	ST1A1_HUMAN	Polymorphism	1042014	B	E	151	D
3	UniProt	VAR_057339	E	151	Q	ST1A1_HUMAN	Polymorphism	1042011	B	E	151	Q
4	UniProt	VAR_007425	R	213	H	ST1A1_HUMAN	Polymorphism	9282861	B	H	213	H
5	UniProt	VAR_009303	V	223	M	ST1A1_HUMAN	Polymorphism	1801030	B	M	223	M
6	UniProt	VAR_014889	N	235	T	ST1A1_HUMAN	Polymorphism	35728980	B	N	235	T
7	UniProt	VAR_061886	E	282	K	ST1A1_HUMAN	Polymorphism	36043491	B	E	282	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2D06)

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000395609	1b	ENSE00001936796	chr16:28634874-28634452	423	ST1A1_HUMAN	-	0	0	-	-
1.2	ENST00000395609	2	ENSE00001738838	chr16:28631454-28631384	71	ST1A1_HUMAN	-	0	0	-	-
1.3a	ENST00000395609	3a	ENSE00001522261	chr16:28621512-28621252	261	ST1A1_HUMAN	-	0	0	-	-
1.4d	ENST00000395609	4d	ENSE00001701423	chr16:28620180-28620029	152	ST1A1_HUMAN	1-50	50	2	A:8-50 B:8-50	43 43
1.5	ENST00000395609	5	ENSE00001713683	chr16:28619924-28619799	126	ST1A1_HUMAN	50-92	43	2	A:50-92 B:50-92	43 43
1.6	ENST00000395609	6	ENSE00001674358	chr16:28619709-28619612	98	ST1A1_HUMAN	92-124	33	2	A:92-124 B:92-124	33 33
1.7b	ENST00000395609	7b	ENSE00001612517	chr16:28618398-28618272	127	ST1A1_HUMAN	125-167	43	2	A:125-167 B:125-167	43 43
1.8	ENST00000395609	8	ENSE00001795988	chr16:28618176-28618082	95	ST1A1_HUMAN	167-198	32	2	A:167-198 B:167-198	32 32
1.9	ENST00000395609	9	ENSE00001697268	chr16:28617557-28617377	181	ST1A1_HUMAN	199-259	61	2	A:199-259 B:199-259	61 61
1.10a	ENST00000395609	10a	ENSE00001291275	chr16:28617254-28616918	337	ST1A1_HUMAN	259-295	37	2	A:259-295 B:259-295	37 37

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:288
 aligned with ST1A1_HUMAN | P50225 from UniProtKB/Swiss-Prot  Length:295

    Alignment length:288
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287        
          ST1A1_HUMAN     8 SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL 295
               SCOP domains d2d06a_ A: Aryl sulfotransferase sult1a                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 2d06A00 A:8-295 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eee..eeehhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhhhh....hhhhh.hhhhhh...........hhhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..........................hhhhhh.hhhhhhhhhhhhhhhh........... Sec.struct. author
             SAPs(SNPs) (1) -----------------------------Q-----------------------------------------------------------------------------------------------------------------D-------------------------------------------------------------H---------M-----------T----------------------------------------------K------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.4d  PDB: A:8-50 UniProt: 1-50       -----------------------------------------Exon 1.6  PDB: A:92-124          Exon 1.7b  PDB: A:125-167 UniProt: 125-167 -------------------------------------------------------------------------------------------Exon 1.10a  PDB: A:259-295            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.5  PDB: A:50-92 UniProt: 50-92      --------------------------------------------------------------------------Exon 1.8  PDB: A:167-198        Exon 1.9  PDB: A:199-259 UniProt: 199-259                    ------------------------------------ Transcript 1 (2)
                 2d06 A   8 SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL 295
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287

Chain B from PDB  Type:PROTEIN  Length:288
 aligned with ST1A1_HUMAN | P50225 from UniProtKB/Swiss-Prot  Length:295

    Alignment length:288
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287        
          ST1A1_HUMAN     8 SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL 295
               SCOP domains d2d06b_ B: Aryl sulfotransferase sult1a                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 2d06B00 B:8-295 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eee..eeehhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhhhh....hhhhh.hhhhhh...........hhhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..........................hhhhhh.hhhhhhhhhhhhhhhh........... Sec.struct. author
             SAPs(SNPs) (1) -----------------------------Q-----------------------------------------------------------------------------------------------------------------D-------------------------------------------------------------H---------M-----------T----------------------------------------------K------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.4d  PDB: B:8-50 UniProt: 1-50       -----------------------------------------Exon 1.6  PDB: B:92-124          Exon 1.7b  PDB: B:125-167 UniProt: 125-167 -------------------------------------------------------------------------------------------Exon 1.10a  PDB: B:259-295            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.5  PDB: B:50-92 UniProt: 50-92      --------------------------------------------------------------------------Exon 1.8  PDB: B:167-198        Exon 1.9  PDB: B:199-259 UniProt: 199-259                    ------------------------------------ Transcript 1 (2)
                 2d06 B   8 SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL 295
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: PAPS sulfotransferase (54)

Protein domain: Aryl sulfotransferase sult1a (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d2d06a_	A:
1b	d2d06b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1a	2d06A00	A:8-295
1b	2d06B00	B:8-295

(no "Pfam Domain" information available for 2D06)

Asymmetric Unit(hide GO term definitions)

Chain A,B (ST1A1_HUMAN | P50225)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0047894	flavonol 3-sulfotransferase activity	Catalysis of the reaction: 3'-phospho-5'-adenylyl sulfate + quercetin = adenosine 3',5'-diphosphate + H(+) + quercetin 3-sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0050294	steroid sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenolic steroid = adenosine 3',5'-bisphosphate + steroid O-sulfate.
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0009308	amine metabolic process	The chemical reactions and pathways involving any organic compound that is weakly basic in character and contains an amino or a substituted amino group. Amines are called primary, secondary, or tertiary according to whether one, two, or three carbon atoms are attached to the nitrogen atom.
	GO:0006584	catecholamine metabolic process	The chemical reactions and pathways involving any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
	GO:0008210	estrogen metabolic process	The chemical reactions and pathways involving estrogens, C18 steroid hormones that can stimulate the development of female sexual characteristics. Also found in plants.
	GO:0009812	flavonoid metabolic process	The chemical reactions and pathways involving flavonoids, a group of water-soluble phenolic derivatives containing a flavan skeleton including flavones, flavonols and flavanoids, and anthocyanins.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EST	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:101 - Pro A:102	[ RasMol ]
		Ala B:101 - Pro B:102	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2d06
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1A1_HUMAN \| P50225
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ST1A1_HUMAN \| P50225
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ST1A1_HUMAN \| P50225	:	1ls6 1z28 3qvu 3qvv 3u3j 3u3k 3u3m 3u3o 3u3r 4gra

(no "Related Entries Specified in the PDB File" available for 2D06)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 14)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File