Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THIOESTERASE SUPERFAMILY MEMBER2 FROM MUS MUSCULUS
 
Authors :  T. Hosaka, K. Murayama, S. Kishishita, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  06 Jul 05  (Deposition) - 06 Jan 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.72
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Thioesterase Superfamily Member 2, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Hosaka, K. Murayama, S. Kishishita, M. Shirouzu, S. Yokoyama
Crystal Structure Of Thioesterase Superfamily Member2 From Mus Musculus
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THIOESTERASE SUPERFAMILY MEMBER 2
    ChainsA, B
    EC Number3.1.2.-
    EngineeredYES
    Expression System PlasmidPX040902-05
    Expression System Vector TypePLASMID
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymMS0341

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 15)

Asymmetric/Biological Unit (1, 15)
No.NameCountTypeFull Name
1MSE15Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2CY9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CY9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CY9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CY9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2CY9)

(-) Exons   (0, 0)

(no "Exon" information available for 2CY9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:122
 aligned with ACO13_MOUSE | Q9CQR4 from UniProtKB/Swiss-Prot  Length:140

    Alignment length:127
                                    22        32        42        52        62        72        82        92       102       112       122       132       
          ACO13_MOUSE    13 KVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKLGTLHGGLTATLVDSISTMALMCTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLG 139
               SCOP domains d2cy9a1 A: 13-139 Hypothetical protein Them2                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........-........ee....eeeeee............hhhhhhhhhhh..hhhhh..----..eeeeeeeee........eeeee..eee....eeeeeeeeee.....eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2cy9 A  13 KVmFKVPGFD-VLEKVTLVSAAPEKLICEmKVEEQHTNKLGTLHGGLTATLVDSISTmALmCT----PGVSVDmNITYmSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLG 139
                              |     22 |      32        42        52        62       |72| |    |82   |    92       102       112       122       132       
                              |     22 |                42-MSE                      70-MSE|   80     |    |                                                
                             15-MSE   24                                               73-MSE       86-MSE|                                                
                                                                                         75              91-MSE                                            

Chain B from PDB  Type:PROTEIN  Length:133
 aligned with ACO13_MOUSE | Q9CQR4 from UniProtKB/Swiss-Prot  Length:140

    Alignment length:139
                                    10        20        30        40        50        60        70        80        90       100       110       120       130         
          ACO13_MOUSE     1 MSSMTQNLREVMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKLGTLHGGLTATLVDSISTMALMCTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLG 139
               SCOP domains d2cy9b_ B: autom   ated matches                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh---.hhhhh...eeeee...eeeeeee............hhhhhhhhhhhhhhhhhhhh.---..eeeeeee..........eeeeeeeeee....eeeeeeeeee.........eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2cy9 B   1 mSSmTQNLREVmKVmF---GFDRVLEKVTLVSAAPEKLICEmKVEEQHTNKLGTLHGGLTATLVDSISTmALmCTE---PGVSVDmNITYmSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLG 139
                            |  |    10 |  ||  20        30        40 |      50        60        70  |  |  80     |  90|      100       110       120       130         
                            1-MSE     12-MSE  20                    42-MSE                      70-MSE76  80     |    |                                                
                               4-MSE     15-MSE                                                    73-MSE       86-MSE|                                                
                                          16                                                                         91-MSE                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CY9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CY9)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ACO13_MOUSE | Q9CQR4)
molecular function
    GO:0047617    acyl-CoA hydrolase activity    Catalysis of the reaction: acyl-CoA + H2O = CoA + a carboxylate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0051289    protein homotetramerization    The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2cy9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cy9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cy9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACO13_MOUSE | Q9CQR4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACO13_MOUSE | Q9CQR4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CY9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CY9)