2CQK - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE LA DOMAIN OF C-MPL BINDING PROTEIN

Authors :   S. Suzuki, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   20 May 05 (Deposition) - 20 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   La Domain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Suzuki, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama
Solution Structure Of The La Domain Of C-Mpl Binding Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - C-MPL BINDING PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P041004-02
	Expression System Vector Type	:	PLASMID
	Fragment	:	LA DOMAIN
	Gene	:	RIKEN CDNA IOH13489
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2CQK)

Sites (0, 0)

(no "Site" information available for 2CQK)

SS Bonds (0, 0)

(no "SS Bond" information available for 2CQK)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2CQK)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2CQK)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_LA	PS50961	La-type HTH domain profile.	LARP4_HUMAN	113-202	1	A:43-130

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000398473	1b	ENSE00002135853	chr12:50794682-50794811	130	LARP4_HUMAN	1-6	6	0	-	-
1.5a	ENST00000398473	5a	ENSE00001795696	chr12:50821545-50821692	148	LARP4_HUMAN	7-56	50	0	-	-
1.6d	ENST00000398473	6d	ENSE00001593830	chr12:50822718-50822873	156	LARP4_HUMAN	56-108	53	1	A:36-39 (gaps)	14
1.7	ENST00000398473	7	ENSE00001655473	chr12:50824278-50824353	76	LARP4_HUMAN	108-133	26	1	A:39-63 (gaps)	26
1.8b	ENST00000398473	8b	ENSE00001778960	chr12:50829271-50829407	137	LARP4_HUMAN	133-179	47	1	A:63-109	47
1.9a	ENST00000398473	9a	ENSE00001722264	chr12:50831518-50831621	104	LARP4_HUMAN	179-213	35	1	A:109-136 (gaps)	32
1.10a	ENST00000398473	10a	ENSE00001768656	chr12:50834222-50834332	111	LARP4_HUMAN	214-250	37	0	-	-
1.11a	ENST00000398473	11a	ENSE00001696119	chr12:50835373-50835426	54	LARP4_HUMAN	251-268	18	0	-	-
1.12a	ENST00000398473	12a	ENSE00001631045	chr12:50847243-50847455	213	LARP4_HUMAN	269-339	71	0	-	-
1.13a	ENST00000398473	13a	ENSE00001707001	chr12:50848097-50848200	104	LARP4_HUMAN	340-374	35	0	-	-
1.14a	ENST00000398473	14a	ENSE00001631570	chr12:50854918-50855130	213	LARP4_HUMAN	374-445	72	0	-	-
1.15	ENST00000398473	15	ENSE00001681874	chr12:50856365-50856413	49	LARP4_HUMAN	445-461	17	0	-	-
1.16	ENST00000398473	16	ENSE00001745658	chr12:50860742-50860903	162	LARP4_HUMAN	462-515	54	0	-	-
1.17	ENST00000398473	17	ENSE00001714506	chr12:50867198-50867319	122	LARP4_HUMAN	516-556	41	0	-	-
1.18b	ENST00000398473	18b	ENSE00001230497	chr12:50867782-50867950	169	LARP4_HUMAN	556-612	57	0	-	-
1.19f	ENST00000398473	19f	ENSE00002105635	chr12:50869309-50873787	4479	LARP4_HUMAN	613-724	112	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:101
 aligned with LARP4_HUMAN | Q71RC2 from UniProtKB/Swiss-Prot  Length:724

    Alignment length:116
                                   104       114       124       134       144       154       164       174       184       194       204      
          LARP4_HUMAN    95 GPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT 210
               SCOP domains ------------------d2cqka1 A:43-130 La-related protein 4 LARP4                                             ---------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..----------..-......hhhhhhhhhhhhhhhh.hhhhhh.hhhhhh.....eeehhhhhh.hhhhhh...hhhhhhhhhh...eee.....eee.........----.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------HTH_LA  PDB: A:43-130 UniProt: 113-202                                                    -------- PROSITE
           Transcript 1 (1) Exon 1.6d     ------------------------Exon 1.8b  PDB: A:63-109 UniProt: 133-179      ------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.7 UniProt: 108-133 ---------------------------------------------Exon 1.9a  PDB: A:109-136 (gaps) Transcript 1 (2)
                 2cqk A  36 GS----------SG-SSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISG----PSSG 136
                             |       -  || |  44        54        64        74        84        94       104       114       124       | -  |   
                             |         38| |                                                                                         132  133   
                            37          39 |                                                                                                    
                                          40

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: DNA/RNA-binding 3-helical bundle (1299)

Superfamily: Winged helix DNA-binding domain (576)

Family: La domain (9)

Protein domain: La-related protein 4 LARP4 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d2cqka1

A:43-130

CATH Domains (0, 0)

(no "CATH Domain" information available for 2CQK)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 2CQK)

Gene Ontology (6, 6)

NMR Structure(hide GO term definitions)

Chain A (LARP4_HUMAN | Q71RC2)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007010	cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
	GO:0022604	regulation of cell morphogenesis	Any process that modulates the frequency, rate or extent of cell morphogenesis. Cell morphogenesis is the developmental process in which the shape of a cell is generated and organized.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cqk)

	Sites
(no "Sites" information available for 2cqk)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cqk)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2cqk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LARP4_HUMAN \| Q71RC2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LARP4_HUMAN \| Q71RC2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	LARP4_HUMAN \| Q71RC2	:	3pkn

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CQK)