Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF HUMAN CASEIN KINASE 1 GAMMA-1 IN COMPLEX WITH 2-(2-HYDROXYETHYLAMINO)-6-(3-CHLOROANILINO)-9-ISOPROPYLPURINE (CASP TARGET)
 
Authors :  G. Bunkoczi, P. Rellos, S. Das, P. Savitsky, F. Niesen, F. Sobott, O. Fed A. C. W. Pike, F. Von Delft, M. Sundstrom, C. Arrowsmith, A. Edwards, J S. Knapp
Date :  15 May 06  (Deposition) - 15 Jun 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym./Biol. Unit :  A
Keywords :  Wnt Signaling Pathway, Serine/Threonine-Protein Kinase, Kinase, Transferase, Atp-Binding, Phosphorylation, Nucleotide-Binding, Serine/Threonine Protein Kinase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Bunkoczi, P. Rellos, S. Das, P. Savitsky, F. Niesen, F. Sobott, O. Fedorov, A. C. W. Pike, F. Von Delft, M. Sundstrom, C. Arrowsmith, A. Edwards, J. Weigelt, S. Knapp
Structure Of Human Casein Kinase 1 Gamma-1 In Complex With 2-(2-Hydroxyethylamino)-6- (3-Chloroanilino)-9-Isopropylpurine (Casp Target)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CASEIN KINASE I ISOFORM GAMMA-1
    ChainsA
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPNIC28-BSA4
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    FragmentKINASE DOMAIN, RESIDUES 45-352
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCKI-GAMMA 1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 6)

Asymmetric/Biological Unit (4, 6)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2OLP3Ligand/Ion2-(2-HYDROXYETHYLAMINO)-6-(3-CHLOROANILINO)-9-ISOPROPYLPURINE
3PO41Ligand/IonPHOSPHATE ION
4SCS1Mod. Amino AcidS,S-ETHYLTHIOCYSTEINE

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:216 , GLN A:252 , GLY A:253 , HOH A:2287 , HOH A:2288 , HOH A:2289 , HOH A:2291 , HOH A:2292BINDING SITE FOR RESIDUE PO4 A1343
2AC2SOFTWARELYS A:48 , ASN A:63 , TYR A:105 , OLP A:1341 , OLP A:1342 , HOH A:2293BINDING SITE FOR RESIDUE ACT A1344
3AC3SOFTWAREILE A:50 , GLY A:51 , LEU A:58 , LEU A:64 , LEU A:118 , GLU A:119 , LEU A:121 , GLY A:122 , LEU A:171 , ILE A:186 , PRO A:334 , PRO A:336 , HOH A:2113 , HOH A:2281 , HOH A:2282 , HOH A:2283 , HOH A:2284BINDING SITE FOR RESIDUE OLP A1340
4AC4SOFTWARELYS A:62 , ASN A:63 , LEU A:64 , TYR A:65 , ASP A:127 , ASP A:130 , ILE A:333 , PRO A:334 , THR A:335 , OLP A:1342 , ACT A:1344 , HOH A:2285BINDING SITE FOR RESIDUE OLP A1341
5AC5SOFTWAREGLY A:47 , GLY A:61 , LYS A:62 , ASN A:63 , ILE A:72 , TYR A:106 , SCS A:110 , ASP A:130 , PRO A:332 , OLP A:1341 , ACT A:1344 , HOH A:2095 , HOH A:2273 , HOH A:2286BINDING SITE FOR RESIDUE OLP A1342

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CMW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CMW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Asymmetric/Biological Unit (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042084R206KKC1G1_HUMANPolymorphism55799101AR206K
2UniProtVAR_042085V329IKC1G1_HUMANPolymorphism55699712AV329I

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.KC1G1_HUMAN50-73  1A:50-73
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.KC1G1_HUMAN160-172  1A:160-172

(-) Exons   (9, 9)

Asymmetric/Biological Unit (9, 9)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003030521bENSE00001950022chr15:64648386-64648187200KC1G1_HUMAN-00--
1.2ENST000003030522ENSE00001429769chr15:64592922-64592518405KC1G1_HUMAN1-61611A:44-6118
1.3ENST000003030523ENSE00001136526chr15:64551440-6455140041KC1G1_HUMAN61-74141A:61-7414
1.4ENST000003030524ENSE00001136521chr15:64543780-6454371170KC1G1_HUMAN75-98241A:75-9824
1.5ENST000003030525ENSE00001201479chr15:64508912-64508761152KC1G1_HUMAN98-148511A:98-14851
1.6ENST000003030526ENSE00001136509chr15:64506323-64506089235KC1G1_HUMAN149-227791A:149-227 (gaps)79
1.7ENST000003030527ENSE00001756169chr15:64499793-6449970886KC1G1_HUMAN227-255291A:227-25529
1.8ENST000003030528ENSE00001136498chr15:64497148-6449706485KC1G1_HUMAN256-284291A:256-28429
1.9ENST000003030529ENSE00001136494chr15:64496788-64496640149KC1G1_HUMAN284-333501A:284-33350
1.10ENST0000030305210ENSE00001136488chr15:64495388-64495281108KC1G1_HUMAN334-369361A:334-3396
1.12ENST0000030305212ENSE00001354885chr15:64472653-64472547107KC1G1_HUMAN370-405360--
1.13aENST0000030305213aENSE00001259031chr15:64464184-644577166469KC1G1_HUMAN405-422180--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:295
 aligned with KC1G1_HUMAN | Q9HCP0 from UniProtKB/Swiss-Prot  Length:422

    Alignment length:296
                                    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333      
          KC1G1_HUMAN    44 FRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGS 339
               SCOP domains d2cmwa_ A: automated matches                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 2cmwA01 A:44-121 Phosphorylase Kinase; domain 1                               2cmwA02 A:122-339 Transferase(Phosphotransferase) domain 1                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....eeeeee......eeeeeeee......hhhhhhhhhhhhh........eeeeeee..eeeeeee....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee..........eee......ee..................-......hhhhhh....hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------K--------------------------------------------------------------------------------------------------------------------------I---------- SAPs(SNPs)
                    PROSITE ------PROTEIN_KINASE_ATP      --------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2          -------------Exon 1.4  PDB: A:75-98  --------------------------------------------------Exon 1.6  PDB: A:149-227 (gaps) UniProt: 149-227                               ----------------------------Exon 1.8  PDB: A:256-284     -------------------------------------------------1.10   Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.3      -----------------------Exon 1.5  PDB: A:98-148 UniProt: 98-148            ------------------------------------------------------------------------------Exon 1.7  PDB: A:227-255     ----------------------------Exon 1.9  PDB: A:284-333 UniProt: 284-333         ------ Transcript 1 (2)
                 2cmw A  44 MRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPcGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSL-GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGS 339
                                    53        63        73        83        93       103      |113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333      
                                                                                            110-SCS                                                                                              211 |                                                                                                                              
                                                                                                                                                                                                   213                                                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CMW)

(-) Gene Ontology  (19, 19)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (KC1G1_HUMAN | Q9HCP0)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0051219    phosphoprotein binding    Interacting selectively and non-covalently with a phosphorylated protein.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0016055    Wnt signaling pathway    The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
    GO:0006897    endocytosis    A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
    GO:0018105    peptidyl-serine phosphorylation    The phosphorylation of peptidyl-serine to form peptidyl-O-phospho-L-serine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SCS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cmw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cmw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KC1G1_HUMAN | Q9HCP0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KC1G1_HUMAN | Q9HCP0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CMW)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CMW)