Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF E.COLI ASNC
 
Authors :  P. Thaw, S. E. Sedelnikova, T. Muranova, S. Wiese, S. Ayora, J. C. Alonso, A. B. Brinkman, J. Akerboom, J. Van Der Oost, J. B. Rafferty
Date :  27 Feb 06  (Deposition) - 04 Apr 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (4x)
Keywords :  Asnc, Dna Binding, Ffrp, Lrp Family, Transcription, Dna- Binding, Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Thaw, S. E. Sedelnikova, T. Muranova, S. Wiese, S. Ayora, J. C. Alonso, A. B. Brinkman, J. Akerboom, J. Van Der Oost, J. B. Rafferty
Structural Insight Into Gene Transcriptional Regulation And Effector Binding By The Lrp/Asnc Family.
Nucleic Acids Res. V. 34 1439 2006
PubMed-ID: 16528101  |  Reference-DOI: 10.1093/NAR/GKL009

(-) Compounds

Molecule 1 - REGULATORY PROTEIN ASNC
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: B834(DE3)
    Expression System Taxid: 562
    Mutation: YES
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Strain: B834(DE3)

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (4x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1ASN2Mod. Amino AcidASPARAGINE
2MG1Ligand/IonMAGNESIUM ION
Biological Unit 1 (1, 8)
No.NameCountTypeFull Name
1ASN8Mod. Amino AcidASPARAGINE
2MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:58 , ASP B:58BINDING SITE FOR RESIDUE MG A1154
2AC2SOFTWARETYR A:100 , THR A:101 , THR A:102 , GLY A:103 , TYR A:105 , SER A:106 , GLN A:128 , THR A:136 , GLU A:137 , THR A:138 , HOH A:2064 , HOH A:2066BINDING SITE FOR RESIDUE ASN A1153
3AC3SOFTWARETYR B:100 , THR B:101 , THR B:102 , GLY B:103 , TYR B:105 , SER B:106 , GLN B:128 , THR B:136 , GLU B:137 , THR B:138 , HOH B:2059 , HOH B:2069BINDING SITE FOR RESIDUE ASN B1153

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CG4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CG4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CG4)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_ASNC_2PS50956 AsnC-type HTH domain profile.ASNC_ECOLI6-67
 		  2A:6-67
B:6-67
2HTH_ASNC_1PS00519 AsnC-type HTH domain signature.ASNC_ECOLI24-50
 		  2A:24-50
B:24-50
Biological Unit 1 (2, 16)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_ASNC_2PS50956 AsnC-type HTH domain profile.ASNC_ECOLI6-67
 		  8A:6-67
B:6-67
2HTH_ASNC_1PS00519 AsnC-type HTH domain signature.ASNC_ECOLI24-50
 		  8A:24-50
B:24-50

(-) Exons   (0, 0)

(no "Exon" information available for 2CG4)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:150
 aligned with ASNC_ECOLI | P0ACI6 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:150
                                                                                                                                                                              152 
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143        |-
          ASNC_ECOLI      4 YLIDNLDRGILEALMGNARTAYAELAKQFGVSPGTIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP-    -
               SCOP domains d2cg4a1 A:4-66 Regulatory protein AsnC                         d2cg4a2 A:67-152 Regulatory protein AsnC                                              - SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeeeee........eeeeeeeee.hhhhhhhhhhhhhh...eeeeeee.....eeeeeee.hhhhhhhhhhhh......eeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --HTH_ASNC_2  PDB: A:6-67 UniProt: 6-67                         -------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------HTH_ASNC_1  PDB: A:24-50   ------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2cg4 A    4 YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKPN 1153
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143      1153
                                                                                                                                                                              152|
                                                                                                                                                                              1153


Chain B from PDB  Type:PROTEIN  Length:150
 aligned with ASNC_ECOLI | P0ACI6 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:150
                                                                                                                                                                              152 
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143        |-
          ASNC_ECOLI      4 YLIDNLDRGILEALMGNARTAYAELAKQFGVSPGTIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP-    -
               SCOP domains d2cg4b1 B:4-66 Regulatory protein AsnC                         d2cg4b2 B:67-152 Regulatory protein AsnC                                              - SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeeeee.hhhhh..eeeeeeeee.hhhhhhhhhhhhhh...eeeeeee.....eeeeeee.hhhhhhhhhhhh......eeeeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --HTH_ASNC_2  PDB: B:6-67 UniProt: 6-67                         -------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------HTH_ASNC_1  PDB: B:24-50   ------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2cg4 B    4 YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKPN 1153
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143      1153
                                                                                                                                                                              152|
                                                                                                                                                                              1153
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CG4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CG4)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (ASNC_ECOLI | P0ACI6)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0016597    amino acid binding    Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0043200    response to amino acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ASN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cg4)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cg4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ASNC_ECOLI | P0ACI6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ASNC_ECOLI | P0ACI6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CG4)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CG4)