2BJI - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HIGH RESOLUTION STRUCTURE OF MYO-INOSITOL MONOPHOSPHATASE, THE TARGET OF LITHIUM THERAPY

Authors :   R. Gill, F. Mohammed, R. Badyal, L. Coates, P. Erskine, D. Thompson, J. Cooper, M. Gore, S. Wood

Date :   03 Feb 05 (Deposition) - 11 Feb 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.30

Chains :   Asym./Biol. Unit : A,B

Keywords :   Hydrolase, Aspartic Proteinase Mechanism, Aspartyl Protease, Succinimide, Zymogen (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. Gill, F. Mohammed, R. Badyal, L. Coates, P. Erskine, D. Thompson, J. Cooper, M. Gore, S. Wood
High-Resolution Structure Of Myo-Inositol Monophosphatase, The Putative Target Of Lithium Therapy
Acta Crystallogr. , Sect. D V. 61 545 2005
PubMed-ID: 15858264 | Reference-DOI: 10.1107/S0907444905004038

Molecule 1 - INOSITOL-1(OR 4)-MONOPHOSPHATASE
	Chains	:	A, B
	EC Number	:	3.1.3.25
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Cell Line	:	DE3
	Expression System Plasmid	:	PRSET5A
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Organ	:	BRAIN
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913
	Synonym	:	MYO-INOSITOL MONOPHOSPHATASE, IMPASE, IMP, LITHIUM-SENSITIVE MYO-INOSITOL MONOPHOSPHATASE A1

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 6)

No.	Name	Count	Type	Full Name
1	MG	6	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:1070 , ASP A:1090 , ILE A:1092 , HOH A:2081 , HOH A:2082 , HOH A:2086 , MG A:2278 , MG A:2279	BINDING SITE FOR RESIDUE MG A2277
2	AC2	SOFTWARE	ASP A:1090 , ASP A:1093 , ASP A:1220 , HOH A:2081 , HOH A:2083 , HOH A:2184 , MG A:2277	BINDING SITE FOR RESIDUE MG A2278
3	AC3	SOFTWARE	GLU A:1070 , HOH A:2033 , HOH A:2034 , HOH A:2064 , HOH A:2066 , HOH A:2086 , MG A:2277	BINDING SITE FOR RESIDUE MG A2279
4	AC4	SOFTWARE	GLU B:2070 , ASP B:2090 , ILE B:2092 , HOH B:3103 , HOH B:3127 , HOH B:3130 , MG B:3278	BINDING SITE FOR RESIDUE MG B3277
5	AC5	SOFTWARE	ASP B:2090 , ASP B:2093 , ASP B:2220 , HOH B:3127 , HOH B:3223 , MG B:3277	BINDING SITE FOR RESIDUE MG B3278
6	AC6	SOFTWARE	GLU B:2070 , HOH B:3077 , HOH B:3078 , HOH B:3105 , HOH B:3107 , HOH B:3130	BINDING SITE FOR RESIDUE MG B3279

(no "SS Bond" information available for 2BJI)

Asymmetric/Biological Unit

No.	Residues
1	Leu A:1185	-	Pro A:1186
2	Leu B:2185	-	Pro B:2186

(no "SAP(SNP)/Variant" information available for 2BJI)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMP_1	PS00629	Inositol monophosphatase family signature 1.	IMPA1_BOVIN	87-100	2	A:1087-1100 B:2087-2100
2	IMP_2	PS00630	Inositol monophosphatase family signature 2.	IMPA1_BOVIN	219-233	2	A:1219-1233 B:2219-2233

Asymmetric/Biological Unit (8, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000015548	1	ENSBTAE00000126312	chr14:79902881-79902930	50	IMPA1_BOVIN	-	0	0	-	-
1.2	ENSBTAT00000015548	2	ENSBTAE00000126314	chr14:79905756-79905818	63	IMPA1_BOVIN	1-21	21	2	A:1003-1021 B:2003-2021	19 19
1.3	ENSBTAT00000015548	3	ENSBTAE00000126315	chr14:79906190-79906323	134	IMPA1_BOVIN	22-66	45	2	A:1022-1066 B:2022-2066	45 45
1.4	ENSBTAT00000015548	4	ENSBTAE00000126316	chr14:79908064-79908168	105	IMPA1_BOVIN	66-101	36	2	A:1066-1101 B:2066-2101	36 36
1.5	ENSBTAT00000015548	5	ENSBTAE00000126317	chr14:79909399-79909444	46	IMPA1_BOVIN	101-116	16	2	A:1101-1116 B:2101-2116	16 16
1.6	ENSBTAT00000015548	6	ENSBTAE00000126319	chr14:79911606-79911714	109	IMPA1_BOVIN	117-153	37	2	A:1117-1153 B:2117-2153	37 37
1.7	ENSBTAT00000015548	7	ENSBTAE00000126320	chr14:79915007-79915115	109	IMPA1_BOVIN	153-189	37	2	A:1153-1189 B:2153-2189	37 37
1.8	ENSBTAT00000015548	8	ENSBTAE00000126322	chr14:79922403-79922554	152	IMPA1_BOVIN	189-240	52	2	A:1189-1240 B:2189-2240	52 52
1.9	ENSBTAT00000015548	9	ENSBTAE00000126323	chr14:79923720-79925287	1568	IMPA1_BOVIN	240-277	38	2	A:1240-1277 B:2240-2277	38 38

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:275
 aligned with IMPA1_BOVIN | P20456 from UniProtKB/Swiss-Prot  Length:277

    Alignment length:275
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272     
         IMPA1_BOVIN      3 DPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED  277
               SCOP domains d2bjia_ A: automated matches                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2bjiA01 A:1003-1146 Fructose-1,6-Bisphosphatase, subunit A, domain 1                                                                            2bjiA02 A:1147-1275  [code=3.40.190.80, no name defined]                                                                         -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh...eee......eeehhhhhhhhhhhhhhhhhh...eeeehhhhhh..........eeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..ee.......hhhh.eee.......hhhhhhhhhhhhhhhhh....eee...hhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh..eee............eeeee.hhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------IMP_2          -------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2           Exon 1.3  PDB: A:1022-1066 UniProt: 22-66    ----------------------------------Exon 1.5        Exon 1.6  PDB: A:1117-1153           -----------------------------------Exon 1.8  PDB: A:1189-1240 UniProt: 189-240         ------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.4  PDB: A:1066-1101          ---------------------------------------------------Exon 1.7  PDB: A:1153-1189           --------------------------------------------------Exon 1.9  PDB: A:1240-1277             Transcript 1 (2)
                2bji A 1003 DPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED 1277
                                  1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272

Chain B from PDB  Type:PROTEIN  Length:275
 aligned with IMPA1_BOVIN | P20456 from UniProtKB/Swiss-Prot  Length:277

    Alignment length:275
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272     
         IMPA1_BOVIN      3 DPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED  277
               SCOP domains d2bjib_ B: automated matches                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2bjiB01 B:2003-2146 Fructose-1,6-Bisphosphatase, subunit A, domain 1                                                                            2bjiB02 B:2147-2277  [code=3.40.190.80, no name defined]                                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.....eee......eeehhhhhhhhhhhhhhhhhh...eeeehhhhhh..........eeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..ee.......hhhh.eee.......hhhhhhhhhhhhhhhhh....eee...hhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh..eee............eeeee.hhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------IMP_2          -------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2           Exon 1.3  PDB: B:2022-2066 UniProt: 22-66    ----------------------------------Exon 1.5        Exon 1.6  PDB: B:2117-2153           -----------------------------------Exon 1.8  PDB: B:2189-2240 UniProt: 189-240         ------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.4  PDB: B:2066-2101          ---------------------------------------------------Exon 1.7  PDB: B:2153-2189           --------------------------------------------------Exon 1.9  PDB: B:2240-2277             Transcript 1 (2)
                2bji B 2003 DPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED 2277
                                  2012      2022      2032      2042      2052      2062      2072      2082      2092      2102      2112      2122      2132      2142      2152      2162      2172      2182      2192      2202      2212      2222      2232      2242      2252      2262      2272

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Multi-domain proteins (alpha and beta) (2421)

Fold: Carbohydrate phosphatase (140)

Superfamily: Carbohydrate phosphatase (140)

Family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like (121)

Protein domain: automated matches (20)

Cow (Bos taurus) [TaxId: 9913] (1)

1a	d2bjia_	A:
1b	d2bjib_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Fructose-1,6-Bisphosphatase; Chain A, domain 1 (114)

Homologous Superfamily: Fructose-1,6-Bisphosphatase, subunit A, domain 1 (114)

Bovine (Bos taurus) (1)

1a	2bjiA01	A:1003-1146
1b	2bjiB01	B:2003-2146

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: D-Maltodextrin-Binding Protein; domain 2 (600)

Homologous Superfamily: [code=3.40.190.80, no name defined] (109)

Bovine (Bos taurus) (1)

2a	2bjiB02	B:2147-2277
2b	2bjiA02	A:1147-1275

(no "Pfam Domain" information available for 2BJI)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (IMPA1_BOVIN | P20456)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0008934	inositol monophosphate 1-phosphatase activity	Catalysis of the reaction: myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.
	GO:0052832	inositol monophosphate 3-phosphatase activity	Catalysis of the reaction: myo-inositol 3-phosphate + H2O = myo-inositol + phosphate.
	GO:0052833	inositol monophosphate 4-phosphatase activity	Catalysis of the reaction: myo-inositol 4-phosphate + H2O = myo-inositol + phosphate.
	GO:0052834	inositol monophosphate phosphatase activity	Catalysis of the reaction: myo-inositol phosphate + H2O = myo-inositol + phosphate.
	GO:0031403	lithium ion binding	Interacting selectively and non-covalently with lithium ions (Li+).
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0030145	manganese ion binding	Interacting selectively and non-covalently with manganese (Mn) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0006021	inositol biosynthetic process	The chemical reactions and pathways resulting in the formation of inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
	GO:0006020	inositol metabolic process	The chemical reactions and pathways involving inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
	GO:0046855	inositol phosphate dephosphorylation	The process of removing a phosphate group from any mono- or polyphosphorylated inositol.
	GO:0006796	phosphate-containing compound metabolic process	The chemical reactions and pathways involving the phosphate group, the anion or salt of any phosphoric acid.
	GO:0006661	phosphatidylinositol biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:1185 - Pro A:1186	[ RasMol ]
		Leu B:2185 - Pro B:2186	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2bji
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMPA1_BOVIN \| P20456
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.25
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IMPA1_BOVIN \| P20456
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2BJI)

(no "Related Entries Specified in the PDB File" available for 2BJI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (8, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (20, 20)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File