|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2BDS) |
Sites (0, 0)| (no "Site" information available for 2BDS) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (2, 84)
NMR Structure
|
|||||||||||||||
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2BDS) |
Exons (0, 0)| (no "Exon" information available for 2BDS) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:43 aligned with BDS1_ANESU | P11494 from UniProtKB/Swiss-Prot Length:43 Alignment length:43 10 20 30 40 BDS1_ANESU 1 AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH 43 SCOP domains d2bdsa_ A: BDs-I defensin SCOP domains CATH domains 2bdsA00 A:1-43 Anthopleurin-A CATH domains Pfam domains ------------------------------------------- Pfam domains SAPs(SNPs) -----------------F------------------------- SAPs(SNPs) PROSITE ------------------------------------------- PROSITE Transcript ------------------------------------------- Transcript 2bds A 1 AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH 43 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BDS) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (BDS1_ANESU | P11494)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|