2ZYV - JenaLib

Title :   CRYSTAL STRUCTURE OF MOUSE CYTOSOLIC SULFOTRANSFERASE MSULT1D1 COMPLEX WITH PAPS/PAP AND P-NITROPHENOL

Authors :   T. Teramoto, Y. Sakakibara, M. -C. Liu, M. Suiko, M. Kimura, Y. Kakuta

Date :   29 Jan 09 (Deposition) - 21 Apr 09 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.81

Chains :   Asym./Biol. Unit : X

Keywords :   Sult1D1, Sult, Sulfotransferase, Paps, P-Nitrophenol, Michaelis Complex, Sulfonation Mechanism, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Teramoto, Y. Sakakibara, M. -C. Liu, M. Suiko, M. Kimura, Y. Kakuta
Snapshot Of A Michaelis Complex In A Sulfuryl Transfer Reaction: Crystal Structure Of A Mouse Sulfotransferase, Msult1D1, Complexed With Donor Substrate And Accepter Substrate
Biochem. Biophys. Res. Commun. V. 383 83 2009
PubMed-ID: 19344693 | Reference-DOI: 10.1016/J.BBRC.2009.03.146

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 9)

Sites (9, 9)

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PRO X:47 , LYS X:48 , SER X:49 , GLY X:50 , THR X:51 , THR X:52 , TRP X:53 , LYS X:106 , HIS X:108 , ARG X:130 , SER X:138 , PHE X:142 , TYR X:193 , SER X:227 , SER X:228 , PHE X:229 , MET X:232 , PHE X:255 , MET X:256 , ARG X:257 , LYS X:258 , GLY X:259 , NPO X:1601 , HOH X:2002 , HOH X:2011 , HOH X:2043 , HOH X:2054 , HOH X:2060 , HOH X:2300	BINDING SITE FOR RESIDUE PPS X 1501
2	AC2	SOFTWARE	PHE X:21 , PHE X:81 , LYS X:106 , HIS X:108 , PHE X:142 , ILE X:148 , HIS X:149 , MET X:248 , PPS X:1501 , NPO X:1602 , HOH X:2027 , HOH X:2300	BINDING SITE FOR RESIDUE NPO X 1601
3	AC3	SOFTWARE	TYR X:76 , PHE X:81 , LEU X:84 , ILE X:89 , MET X:243 , GLU X:247 , NPO X:1601 , HOH X:2009 , HOH X:2025	BINDING SITE FOR RESIDUE NPO X 1602
4	AC4	SOFTWARE	ILE X:86 , GLY X:88 , THR X:90 , ASN X:91 , GLU X:185 , GLU X:217 , GLU X:218	BINDING SITE FOR RESIDUE GOL X 1001
5	AC5	SOFTWARE	LYS X:233 , ASN X:239 , THR X:241 , HIS X:250 , PRO X:254 , PHE X:255 , MET X:256	BINDING SITE FOR RESIDUE GOL X 1002
6	AC6	SOFTWARE	GLU X:16 , GLU X:32 , GLN X:112 , LEU X:113 , LEU X:114 , LYS X:222 , HIS X:226 , HOH X:2039	BINDING SITE FOR RESIDUE GOL X 1003
7	AC7	SOFTWARE	PHE X:192 , ASP X:195 , LYS X:290 , ARG X:292 , HOH X:2042 , HOH X:2188	BINDING SITE FOR RESIDUE GOL X 1004
8	AC8	SOFTWARE	GLY X:88 , TRP X:119 , LYS X:120 , TYR X:186 , GLU X:218 , HOH X:2175 , HOH X:2223	BINDING SITE FOR RESIDUE GOL X 1005
9	AC9	SOFTWARE	LYS X:209 , GLU X:212 , THR X:242	BINDING SITE FOR RESIDUE GOL X 1006

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain X from PDB  Type:PROTEIN  Length:289
 aligned with ST1D1_MOUSE | Q3UZZ6 from UniProtKB/Swiss-Prot  Length:295

    Alignment length:289
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285         
          ST1D1_MOUSE     6 DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE 294
               SCOP domains d2zyvx_ X: automated matches                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2zyvX00 X:6-294 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee..eeehhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh....hhhhh.hhhhhh.....ee...eehhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.............................hhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zyv X   6 DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSE 294
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain X (ST1D1_MOUSE | Q3UZZ6)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006584	catecholamine metabolic process	The chemical reactions and pathways involving any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0000103	sulfate assimilation	The pathways by which inorganic sulfate is processed and incorporated into sulfated compounds.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NPO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PPS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser X:101 - Pro X:102	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2zyv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1D1_MOUSE \| Q3UZZ6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.9
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description